754 episodes - 430 hours of Clif High.

Clif High
2026
2026 - April (2)
14 Apr 2026 Tue
Clif High / Time Enough for Love
#yamanaka factorsweb bot systemvaccinesalien contactartificial intelligenceauric effectcolon cancerfinancial systemslocal networklongevity researchponzi schemeprecog abilityrobert heinleintime enough for lovetime travel theoryufo phenomenaufos
00:26:58
07 Apr 2026 Tue
Clif High / Knob Boys
#social unrestsleeper cellssean ryanchristian populationcity of londondonald trumpeconomic collapsegeopolitical strategyglobal power structuresiraniran iraq conflictisraelknob boysmainstream medianationalist movement
00:20:53
2026 - January (5)
10 Jan 2026 Sat
Clif High / Cancer is all in our minds.
#traditional butthead medicinesv40sean david mortonalternative medicinecancer causationchaga mushroomschemotherapyconsciousness manipulationcorey goodfenbendazolegospel of thomasjapanese yogajay weidnerkarmic reincarnationmind over matterneville goddardradiationrick simpson oil
00:29:39
10 Jan 2026 Sat
Clif High / Grist for the mill of our common shared reality.
#time travel theorysmith mundt actshared realityanesthesia induced amnesiabeyond mysticcatherine austin fitzconspiracy narrativescorey gooddavid wilcockevent streamgaia platformheidi vandenbergjay widenerlegal jurisdictionrichard dolansecret space program
00:43:42
07 Jan 2026 Wed
Clif High / A long and winding road...
#robert goddardpure sleeppax judaicaapophisbrett weinsteinchromosome twocliff highconsciousness creates realitycorey goodecritique of evolutionary biologyelohimextraterrestrial genetic engineeringgovernment disclosure of aliensheather hayingjoe roganmanifestation and illusionneville goddard
02:29:39
03 Jan 2026 Sat
Clif High / Strategy...
#weimar republicvenezuela politicsus election integritybricsbrics allianceccpcentral bank digital currencycommunist chinese partydonald trumpfdicfederal deposit insurance corporationfederal reservefentanyl traffickingfraudulent voting machinesglobal financial collapsenicolás maduro
00:24:54
01 Jan 2026 Thu
Clif High / HOLDFAST!
#ufo suppressiontrumpedossocial unrest3i atlaschemtrailscitizen journalistsconspiracy theoriescryptocurrenciescurrency devaluationeconomic collapsefederal reservehyperinflationmedia corruptionngossilver explosion
00:32:41
2025
2025 - December (9)
28 Dec 2025 Sun
Clif High / Week One...
#weimar republicweek onethree eye atlasalien technology claimschemtrailscincinnati noisescommodity mercantilismdepartment of warfiat currency collapsefinancial networkismhenry kissingerhyperinflation crisismercantilismpetrodollarpetrodollar systemsci fi worldsilversilver price surge
00:26:18
26 Dec 2025 Fri
Clif High / Fly Eternal Now Airlines!
#time travel debunkedspace time warpingsanskrit hymnsalien spacecraftancient alien textscherubsconsciousness substratecorey goodeelohimeternal noweye of hathoreye of horusmental batteriesmonoatomic goldreality perception
00:23:56
24 Dec 2025 Wed
Clif High / Opps...there's an alien in your religion!
#vaticantalmudistsreligious paradigms2026 crisis3e atlasalien contactbiblecatholic churchconsciousness substratedavid serretaelohimislamjudeanskali yugamuhammadnew testamentquran
00:29:10
22 Dec 2025 Mon
Clif High / You Koi can't handle the truth!
#whistleblowersufosuapsalternative newsciaconspiracy theoriescorey gooddavid wilcockemery smithfree willgovernment controljason giorgianikerry cassidykoi pond analogyspiritual paradigmssupreme consciousnessuap phenomena
00:26:00
18 Dec 2025 Thu
Clif High / Hypercomplexity emerges...2026 through 2050
#yuktasvarufostechnological singularityage of enlightenmentalien contactanti gravity devicesartificial intelligencecatholic churchconsciousness studiesdirected energy weaponsfiat currencyfinancial systemskali yugamartial artsreverse engineeringspiritual cycles
00:29:21
17 Dec 2025 Wed
Clif High / Clean up YOUR event-stream.
#vaticanufo disclosureuaps20263i atlasai limitationsashkenazi peopleconsciousness ontologydonald trumpelohimgrittologygroup manifestationjewish history claimsjudeansreligious paradigm shiftremote viewingsupreme consciousness
00:21:48
10 Dec 2025 Wed
Clif High / Last Prophet of YHWH
#vaticanufo communityspace aliens2027age of disclosurebeau polonychristian influencersconspiracy theoriesextraterrestrial disclosuregovernment controlheidiisraelkim clementold testamentreligious paradigm shiftsolar storming
00:23:43
06 Dec 2025 Sat
Clif High / Alignment + Convergence
#yuga transitionyahwehvenus3i atlasconsciousness as realitydwapara yugaearthelohiminterstellar gas cloudjupiterkali yugamanifestation techniquesmarsmercuryplanetary alignmentsunvagus nervevagus nerve health
00:42:39
03 Dec 2025 Wed
Clif High / Process of manifestation
#x platformsupreme consciousnessspiritual conspiracy theoriescancer survivalconsciousness theoryenergy harvestinghypothalamuslanguage centermanifestation techniquesnasara gasara dinar scamneuroscience of emotionneville goddardphariseespituitary glandsocial media manipulationsoul
00:30:03
2025 - November (7)
29 Nov 2025 Sat
Clif High / Alien complexity collision
#ufo presidentuapstarlink3e atlas3i atlasconsciousness theorydonald trumpelon muskextraterrestrial intelligencegospel of thomasgovernment secrecymake america healthy againmanifestation spiritualityneville goddardphysical culture mandates
00:36:20
21 Nov 2025 Fri
Clif High / Bank Wars & Novel Territory
#world economic forumus civil warunited nations3i atlas asteroidandrew jacksonbanking panicbitcoinbitcoin adoptionbritish banksdonald trumpeconomic depressionfederal reservefiat moneyfinancial historysecond bank of the united states
00:16:45
19 Nov 2025 Wed
Clif High / Self Serve Reality
#transgender individualstalmudismshungite stonescolon cancerconsciousness creationethergender biologygritologylemmamanifestationmatter illusionmind body controlneville goddardpc musclepineal glandpituitary gland
00:52:44
18 Nov 2025 Tue
Clif High / Self Serve Reality
#transgender individualstalmudist thinkingsupreme consciousnesscolon cancerconsciousnessgender differencesgospel of thomasgritologylemmamanifestationmatterneville goddardpc muscleshungitespiritual healing
00:52:58
16 Nov 2025 Sun
Clif High / The New You emerges in 2026.
#tartarian buildingsneville goddardmanifestation paradigm20263i atlasamuamuaconscious co creationcorey goodedavid wilcockextraterrestrial contactfederal reservefinancial collapsegiza pyramidsglobal control systemsgrittology paradigm
00:38:26
15 Nov 2025 Sat
Clif High / What it was like when i died.
#surf rescuesupreme consciousnessspiritual awakeningcolon cancerconsciousnessdrowningelizabethkarmamescalinenear death experiencesoverdosepre birth experiencereincarnationsoul container
00:51:46
04 Nov 2025 Tue
Clif High / Sneaky (Alien) Concept
#subconscious manifestationresonance processreligious dogma critiquealien interventionaliensbibleclaustrumco creators of realityconsciousness anatomyeternal nowmanifestation commandmonadpineal glandpituitary glandpleromareality bendingreality co creationreligious dogma
00:12:54
2025 - September (4)
14 Sep 2025 Sun
Clif High / Ontology, Simulation, 3IATLAS
#supreme consciousnesssimulation theorysimulation hypothesis3i atlasbrahmas dreamconsciousness theorycyanide based engineelectromagnetic fieldsemotional tension dataextraterrestrial intelligencegovernment controlgrittologynikolai kozyrevontological realitypsyop
00:43:08
10 Sep 2025 Wed
Clif High / Science experiments on going...
#zionist groupssimulation theorysharia law2027 predictionalien contactautismconsciousnesscovid 19 vaccinescryptocurrencyelohim worship culteternal nowevent streamheidikarmic feedback loopsmuhammadismneville goddardreality manipulation
01:18:09
07 Sep 2025 Sun
Clif High / Resurrection 2027
#vaimanaithe bugsocietal collapseamperes lawancient technologyanunnakielohimelon muskhuman evolutionhyperspacemagnetic entrainmentmelaninmind machine interfaceold farts groupreligious beliefsresurrection 2027
00:51:25
01 Sep 2025 Mon
Clif High / 3IATLAS Aliens Consciousness
#ufo briefingstime perceptionterence mckenna3i atlasastrological energiesavi loebcongressentrainmenteschatonextraterrestrial intelligencegovernment incompetencegreen projectileslockheed martinnon human consciousnessoumuamuastargatestock market crash
01:00:26
2025 - August (5)
19 Aug 2025 Tue
Clif High / i blame Heidi too
#zionist frameworkzionism critiquevedic literaturebhagavad gitaconsciousness theorydesign patternsgazagritologistsheidiisraeliskarma and destinylaw of attractionprobability cloudsocial classessoul age
00:43:09
16 Aug 2025 Sat
Clif High / Common Shared Reality
#zero point technologyzero point energyxrpage of aquariusbo polonycentracoincommon shared realityconsciousness creates realitycorey goodecryptocurrency regulationdavid wilcockelohim worship cultevent stream theoryfbi intimidationgreat resetgreat reset conspiracyjason ip4karmic causalitysec subpoenaworld economic forum
01:13:35
13 Aug 2025 Wed
Clif High / Changes
#smithsonian institutionsilver pricesset theoretic mathematics2003 prophecybo pehnayconspiracy theoriescovid 19cryptocurrencydonald trumpelohim worship cultevent streamgovernment controlkim clementnew electricsprophecy
00:40:00
11 Aug 2025 Mon
Clif High / KARMA WARS!
#selenitespredictive programmingmateriumalien warfareartificial intelligenceavi loebcolon cancerconsciousness realitycorey goodedavid wilcockdeep state programmingelohimevent streamjewish peoplekarmakarma mechanicsliberalism
00:53:59
04 Aug 2025 Mon
Clif High / Perplexity
#x channelsvucasubstack3i atlasciaconsciousnessdeep stateevent streamfbigreat awakeningheidiinfjjanuary 6thladder testnsapredictive programmingrule of assumptionsigma malespace aliens
01:07:40
2025 - June (4)
21 Jun 2025 Sat
Clif High / Welcome to The Time Zone
#tartariasummer of emergencesmithsonianalternative historyanti gravity vehicleschemtrailsconspiracy theoriesdarwinismdemiurgefree energy technologyheidinew age movementsnormiespseudoscience
00:49:07
05 Jun 2025 Thu
Clif High / TEOTWAWKI 2027
#zero point technologyzero point energyufo intervention2027 meteor impactalien contactanti gravity forcescommunist paradiseeconomic collapsefake alien invasionfiat currenciesheidijune 5thnon debt based currencyontological paradigm shiftqualiaquantum computingsilver price
00:36:29
03 Jun 2025 Tue
Clif High / Expectation of Revelation
#zero point energythe secrets revealedspace time controlbreakaway civilizationsconspiracy theoriesdollar degradationdonald trumpfree energyheidijoe bidennatonuclear threatspsi metalrussiasilver price breakoutsilver price prediction
00:29:07
02 Jun 2025 Mon
Clif High / !The Under Pressure!
#wokistsswami vivekanandasri aurobindochemtrail conspiracychemtrailscommunistsconsciousness pressureconspiracy theoriescorey goodedavid wilcockdemographic declinedonald trumpfascistsjoe bidenkarmic backlashmark richardsmarxistsrabindranath tagorereincarnation
00:31:03
2025 - May (5)
28 May 2025 Wed
Clif High / i blame heidi
#woodbury islandthinking and destinyspiritual awakeningafterlife beliefschemtrail hazecolon cancercovid eraeverett naval baseharold percivalheidikarmametaphysical theoriesmyrtle beachpre birth memoriesreincarnationspace aliens
00:51:02
21 May 2025 Wed
Clif High / Trade Craft for Woo
#wu peopletarotshinshin soitsu doastrologybitcoinbitcoin predictioncathari womencatholic churchconsciousness artsfuture educationheidiqualiaquantum computing
00:25:51
21 May 2025 Wed
Clif High / Many Questions...
#voyager 1technological inequalitysycamorebrain alterationextraterrestrial intelligencegalactic centergovernment censorshiplucifermoonnasanon human intelligencequantum computerquantum computingsolar system
00:39:05
13 May 2025 Tue
Clif High / Ontology tools.
#vedic astrologytranshumanismtarot readingconscious mind biasentangled qubit chipsevent streamheidikarmic engineontology toolspredictive aipsychic abilitiespsychic slavesqualiaquantum computingsecret space programs
00:22:05
07 May 2025 Wed
Clif High / Self Revealing Noodle Twist
#voyager spacecrafttemporal anomaliessycamore quantum chip2001 a space odysseyconsciousness theoryfourth turningglobal consciousnessglobal consciousness bubblehuman coherencyitzhak bentoffmichio kakuneural functioningontological eventpsychosocial cyclesquantum computingsolar system barrierspace explorationstalking the wild pendulum
00:41:25
2025 - April (10)
22 Apr 2025 Tue
Clif High / Emerging Now: Part 3, part 2
#zero point technologysufismshin shin soitsu doaikidoalien contactbitcoinbo polnybrotherhood of the afflictedconsciousnessdonald trumpelon muskepstein listfederal reservefinancial collapseheidiontologyqualia
01:02:32
22 Apr 2025 Tue
Clif High / Emerging Now - Part 3; part 1
#zero point technologytartarian structurestalmudic jewsastrological cyclescathari lineagedemiurgeepstein related informationether pirates of this materiumglobal conspiracy theorieskali yugaq drop materialreligious declinesecrets revelationsingularitysummer of emergence
00:15:35
16 Apr 2025 Wed
Clif High / Emerging Now: Part 2
#warren westonvladimir putinuap sightingsalien civilizationsbo polnyconsciousness realitycryptocurrencydoge departmentepstein materialetherfinancial collapsegrittologygrokpetrodollarplancks constantreligious critiqueshuhari
00:38:12
16 Apr 2025 Wed
Clif High / Emerging Now: Part 1
#weiss computerswarren westonvancouverbo polnybritish columbiacbdcconspiracy theoriesdark star anomalygalactic centergroknumerologysmith mundt actsolar activityunidentified aerial phenomena
00:12:38
10 Apr 2025 Thu
Clif High / Speculation during Chaos.
#zero point energysound moneyrockefellersanti gravity enginesblack project machinesbond warboom and bust cyclescentral bankingdebt based systemsdonald trumpeconomic collapseillegal digital dollarsjim sinclairpetrodollar system
00:20:32
09 Apr 2025 Wed
Clif High / Mo'Debt
#zero point technologyzero point energyunited statesblack project money machineschinacurrency warsdepartment of government efficiencydogeepsteineuropean unionfederal reserveglobal economic collapseisraelmercury retrogradepetrodollar collapserockefeller familyrothschild familysound money systems
00:43:16
07 Apr 2025 Mon
Clif High / Secrets Revealed - Black Money Machines
#vanguardtrump administrationstock market crashalien technologyblackrockconspiracy theoriesdeflationary crisisdepartment of government efficiencydogeeconomic collapseelohim worship cultfederal reservehuman traffickingreverse engineered alien technology
00:30:14
05 Apr 2025 Sat
Clif High / Qualia too...
#synchronicitysarah westallqualiaapril 5thcats cradleconfirmation biasdtcfraudulent stock rehypothecationgrand falloonheidikarmakavasmessiah complexontologypacific coast
00:20:09
04 Apr 2025 Fri
Clif High / Ontology is self revealing.
#yahwehworld economic forumrobert maxwellartificial intelligencecarrie cassidychemtrailsconspiracy theoriesdavid wilcockdeep statedoge teamedgar cayceel elyonepsteingabrielgrittologymichaelontologypacific coast
00:40:07
03 Apr 2025 Thu
Clif High / Karma. Not a bitch, but an engine.
#vikinguniverse guidancesingularity transitionanalog universe sensorsanti gravity vehiclesashkenaziastrological transitsconsciousness technologydraco reptiliansetherfree energygrittologyheidikarma mechanicskhazarianmossadontological paradigmscythiansingularity
00:18:16
2025 - March (5)
30 Mar 2025 Sun
Clif High / Great Manifestations.
#weather warsweather manipulationwaffle radiationchemtrailsconsciousness ontologydeep stateepstein fileseternal nowevent streamjay widenerjfk documentsontologyqualiaselenitessingularity theoryunfolding singularity
00:56:20
28 Mar 2025 Fri
Clif High / Why i can't share my amino / tonic stack
#vitamin cvariable frequency lightsupplement safetyalternative medicineamino acid stackb12biohacking risksboroncolon cancer recoveryee systemsgrokibuprofenikea bodyjeff berwickmedical skepticismmorie ushibanacnsaidspersonal healthscalar waves
00:24:07
27 Mar 2025 Thu
Clif High / Housing, currency, Money & Aliens.
#who built the moonselenitesreal estate marketalien disclosurebangor submarine basebruce was bruceconspiracy theoriescryptocurrencyfederal reservefinancial collapseheidijay widenerjohn f kennedyjoni petricelockheed martinmoneromossadnikita khrushchevnorth puget sound
01:01:31
19 Mar 2025 Wed
Clif High / One thousand times future.
#secret space programsmoneroloxistsadrenochromealien technologybitcoincivil warcommercial real estatecommon law courtsconspiracy theoriescryptocurrencydoge teameconomic collapseelon muskepsteinfederal reservejewish supremacistsjfk files
00:40:41
14 Mar 2025 Fri
Clif High / Summer of Emergence
#zero point energywoo beginningsvedic astrologyalternative medicineastrologybitcoinconspiracy theoriescryptocurrencyfederal reservefinancial collapsegoldgovernment corruptionmercury retrogradepurebulkpure sleeprfk jrstablecoinsstephen greer
00:32:26
2025 - February (17)
17 Feb 2025 Mon
Clif High / Psytech
#zero point energypsytechphariseesartificial intelligenceblackrockchristian revivalconsciousness researchcorporate espionagedepartment of defensedick algaierelohimevent streamfuture forecasting groupgritologyirish peopleontological paradigm
00:17:03
16 Feb 2025 Sun
Clif High / Light
#zptzero point technologytechnological scamsalien technologyanalog aianti vaccine claimsaura photographybiophotonic medicinebiophotonscarrie cassidyee systemsfluorescent tubesfrequency patchesreversed engineered alien shipsscalar waves
00:14:51
15 Feb 2025 Sat
Clif High / Religious cattle
#zero point technologytrump tower explosionspace aliensai auditblack projectsciaconspiracy theoriesdepartment of defenseelohim worship cultfalse flag operationsgovernment efficiencyinternational geophysical yearlanghornsmoon landingreligious conflict
00:16:18
14 Feb 2025 Fri
Clif High / For my Valentine
#valentines day originssaint valentineroman empire historybrassiecathar christianitycatharsdemiurgeemperor claudiusherbal tonicsoperation mockingbirdperfectiphariseesreincarnationreincarnation beliefs
00:12:55
13 Feb 2025 Thu
Clif High / Normies, and space aliens...
#zero point energyphariseeskhazarian mafia2032adrenochromealien structures on the moonaugust 2025bruce c zallconspiracy theoriesdeep stateelohimextraterrestrial disclosurefebruary 13freemasonshuman harvestingjune 2025
00:14:06
12 Feb 2025 Wed
Clif High / Pharisees and asteroids
#second temple periodrnd functionquantum computingadrenochromecernconsciousnessdeterminismelohimevent streamgod particlesgritologymarxismobserver effectontologypharisees
00:14:22
11 Feb 2025 Tue
Clif High / Twenty Percent
#woke agendastrump administrationsocial security bankruptcydemocratsdepartment of defenseelohim worship cultfebruary 26thfederal reservefederal reserve systemfinancial collapseglobalist conspiracyglobalistshedge fundsnon vaxxed individualssocial conflict
00:13:18
10 Feb 2025 Mon
Clif High / Legal Freeze...
#street violencesecuritiespolice confrontationblm style actionsbondscommon lawcommon law returncorporate contractsdata analysisdata destructionfebruary 26thfinancial contentionfinancial corruptioninternational court systemslegal derailment
00:07:25
09 Feb 2025 Sun
Clif High / Psy Waves
#societal transformationp wavespsychic phenomenagalactic centergalactic center wavesgratologykaraskurt vonnegutmaterialismmental instabilityontological shiftontologypsi wavespsychic awareness
00:12:22
08 Feb 2025 Sat
Clif High / Confluence
#zero point technologywu guysworld economic forumalien encountersblack project fundingchemtrailsconspiracy theoriescory godbeydemocrat communistselohim worship cultepstein listglobal tensiongovernment surveillancepharisees
00:15:27
07 Feb 2025 Fri
Clif High / Watch the Water...
#zero point technologyzero point energywatch the wateralbert einsteinblack projectsbreakaway civilizationeducational reformextraterrestrial lifegovernment conspiracymount rainierphariseean led deceptionscientific paradigm shiftsecrets revealedspace aliensufosusa taxpayers
00:07:55
06 Feb 2025 Thu
Clif High / Secrets Revealed
#zero point technologyusaidunited nationsalien contactbill gateschild traffickingconspiracy theoriesdemocratsfebruary 26thfinancial collapseglobal governancehillary clintonsecrets revealedspace alienstechnological revelation
00:11:27
05 Feb 2025 Wed
Clif High / Curiendero
#zero point technologyzero point energywhite coat physiciansai healthcarealternative medicineanti gravity dronesbig pharmabig pharma critiquebiochemical databasescuranderocurandero healingheroin addictionhood canalorganic farmingseaweed farmself dosing agents
00:08:57
04 Feb 2025 Tue
Clif High / Chrysilis
#spiritual transformationspace aliensphariseesage of aquariusage of piscesage of taurusalien contactastrological agescaterpillar chrysalisfebruary 4thgalactic centergalactic center energygrittologyjew dominated physicskarmamateriumparadigm shift
00:10:17
03 Feb 2025 Mon
Clif High / Windows to the soul
#turkish literatureteutonic literatureremote viewing1993 mexico city earthquakeancient mythologyaurasbiophotonschinese literaturedick algaierenergy fieldshindu literaturehuman consciousnesslight emissionmedical professionalsmoon
00:09:24
02 Feb 2025 Sun
Clif High / Spring Offensive
#zero point technologyvietnam warufo activity2025 predictionsantifaantifa violenceccpchemtrail conspiracychemtrailsfifth columnistsfinancial instabilitylegacy mediangosportland oregonsocial order shiftspring offensivetet offensiveuap
00:16:38
01 Feb 2025 Sat
Clif High / That complex bitch!
#psychedelicspsychedelic effectsmental statebhagavad gitadownstream effectsemotional balanceevent streamevent stream theoryflashbackshyperspacekarmakarma and actionkatharimental reintegration
00:11:44
2025 - January (9)
31 Jan 2025 Fri
Clif High / Failing
#woke mind virusvernanskyukesbinary realitycommunistselohim worship culthydrogen ionlearning through failuremartial artsrapunzelrichard feynmansocial obstaclestime travel impossibility
00:09:44
30 Jan 2025 Thu
Clif High / Arrogant bastard
#woke mind viruswoke ideologywefaikidobiological determinismbiological imperativesbrazilian jiu jitsucommunistcourtshipdating advicegender identityhormonesromantic literaturetraditional romancetransgender ideology
00:15:35
29 Jan 2025 Wed
Clif High / Shift Happens...
#zero point energywashington statetaurus eraage of aquariuscartesian coordinatesconspiracy theorieseinstein relativityether theorykali yugakali yuga cyclekhazarian mafiaoil industrypisces eraregenerative medicinescientific paradigm shift
00:24:37
29 Jan 2025 Wed
Clif High / Shi ho nage
#white belttaoismspiritual evolutionage of aquariusaikidoaikido historybuddhismgeneral douglas macarthurmartial arts masterymental masteryself controlshihonage
00:13:35
28 Jan 2025 Tue
Clif High / Red tape
#stalkerred tapepublic harassmentcelebrity statuscolleaguescult leadercult leader accusationsgihuman stupidityinefficienciesmartial arts etiquettepersonal boundaries
00:07:08
28 Jan 2025 Tue
Clif High / testing
#zen meditationself evaluationscent testingbattlefield promotionereternal nowjanuary 28judokorean warmartial artsmartial arts philosophymuscle hangoverspersonal responsibilitypresent moment awarenessrank
00:09:03
27 Jan 2025 Mon
Clif High / power talks
#zero point energytribal loyaltysecond templeage of aquariusbabylonian money magicchemtrail industriesdronesfebruary 2025financial systemsgovernment collapsepetrodollarphariseesreconquista
00:14:23
26 Jan 2025 Sun
Clif High / Here, take my hand...
#violence controlukeself masteryaikidoaikido philosophydisciplined violencefreemasonsjapanese verb ukitorukarmamartial artsmasakatsu agatsumasters of contentionnagepartnership dynamicssecret society
00:09:00
25 Jan 2025 Sat
Clif High / An Olde Phartes story about cold toes.
#usosundersea unknown objectsunconventional problem solvingcavitationconsciousnessconsciousness technologyelectromagnetic frequenciesemfmetal hullmikenaval anomaliesscalar energysoftware engineeringsouthwest pacificsubmarines
00:25:19
2024
2024 - December (11)
22 Dec 2024 Sun
Clif High / Curious.
#unidentified anomalous phenomenauapsuap phenomenaalien encountersconcealed carry permitdick algaiereconomic instabilityfiat currencyfinancial crisisfuel shortagesgaza conflictkerry cassidynew jerseynew yorknormiespuget soundsocietal tensiontrump assassination attempt
00:24:24
22 Dec 2024 Sun
Clif High / Saturation by late Feb?
#yaleuap phenomenareligious critiquecabalcarrie cassidyconspiracy theoriescourtney browndeep statedonald trumpdsouzaelohimgender dynamicsharvardjudaismmitnaomi wolfphysics paradigms
00:29:15
22 Dec 2024 Sun
Clif High / Your paradigm is loose...
#william tompkinsufo sightingstrump inaugurationcabal activitiescarrie cassidyconspiracy theoriescorey goodcourtney browndavid wilcockee systemsextraterrestrial lifeprime directiveradioactive debrissavati scamscalar energy
00:41:06
14 Dec 2024 Sat
Clif High / The Force Wants YOU!
#woke mind virussupreme consciousnesssun diseasearjunaconsciousness as illusionglobal order collapsegod particlejedi waykrishnanew world ordernon terrestrial intelligenceontological physicso physicspredictive linguisticsstolen election
00:15:05
14 Dec 2024 Sat
Clif High / Blue Haired Demiurge
#woke mind virustinfoil hatsshock therapy276 ad rome455 ad greece783 hertzarchon consciousnessbioelectrical fieldsbiophotonicchagachemtrailsdemi urgehewlingjacksonmateriummichael persingerparasitic consciousnessrishi mushroom spore oilschumann resonance
00:56:36
06 Dec 2024 Fri
Clif High / If gov't can't lie....
#yeshuawoke mind virusuap conferencesartificial intelligencecarrie cassidycharlie wardconspiracy theoriesconstantinecorey goodecryptocurrency marketsdavid wilcockeusebiusgovernment transparencykrishnanassaraphil godluskiqfsquantum computingsecret space program
00:33:21
06 Dec 2024 Fri
Clif High / The Ontology...
#yahwehtorahtalmudchristianityconsciousness ontologyelohimfrankincensegabrielislamjewish deitiesjudaismkerry cassidymichaelmind body harmonynon material realityparasitic consciousnessreligious collapseshinshin soitsu do
00:48:11
06 Dec 2024 Fri
Clif High / AI Lie Detector
#wolconianswano sabanvocal cord vibrationsai technologycancer curecharlie wardconsciousness theorycorey goodecourt testimonyearth resonance fieldfacial micro expressionskerry cassidylie detectionspeech ontologytransgender rights
00:06:07
03 Dec 2024 Tue
Clif High / Hello Chromies!
#zptzero point energyufoscelebrity endorsementschromiesearthersemotional cachetencryptionfbifuture currencygovernment ineffectivenessgritologistsinterstate systemlanguage evolutionlocalized space dataoff worlderssocial currencyufo disclosure
00:23:33
03 Dec 2024 Tue
Clif High / CONVASION!
#wokoniansufo sightingssouth koreaalien reproduction vehiclesbeyond mysticblue chicken cultchemtrailscolor revolutionconspiracy theoriescorey goodedeep stateextraterrestrial contactfinancial collapsegeopolitical conflictgeorgiaharrison smithinfowarsjordan sathermaga
00:32:08
01 Dec 2024 Sun
Clif High / TRUMP FUCKS UP!
#zero point technologyzero point energyufosdebt based currency systemdollardonald trumpeconomic chaoselohim worship cultfederal reservefederal reserve critiqueglobal financial collapsegoldjew owned central banksoilpetrodollarrussiatariffs
00:44:10
2024 - November (5)
20 Nov 2024 Wed
Clif High / Ontological Evolution
#zero point energyufo conspiracy theoriestalmudalien contact claimsbomb cyclonecarrie cassidychristianityciaclown worldconsciousness levelscorey goodedavid wilcockdeep statedeep state allegationsgaia mediaislamjudaismmichael sallareligious obsolescence
00:38:34
20 Nov 2024 Wed
Clif High / Connotation Collision
#wolconianstransgender individualsreligious connotationsage of reasonbiblebomb cyclonebo polneyboscovichcommunist ideologuesconnotationdenotationelohim worship cultgratology worldlanguage distortionontology world
00:07:20
14 Nov 2024 Thu
Clif High / Death and Aliens, part 2
#zero point energyufo disclosuresv40alternative medicineanti gravity technologycalcium silica imbalancecarrie cassidychemtrailsconspiracy theoriesextraterrestrial lifegovernment controlnhio physicssalk polio vaccinesilica
00:32:05
14 Nov 2024 Thu
Clif High / Death and Aliens, part 1.
#yogic manualsstem cell repopulationmirana maranaai research applicationsancient esoteric practicescaucasus mountainscolon cancercolon cancer recoverydetoxification protocolselegant poisonshindu practicesjapanese buddhist self mummificationkailasha antakayak kalpamicroplastics
00:17:34
08 Nov 2024 Fri
Clif High / License to Offend
#woke mind virustalmudquantum physics critiquebrian keatingconsciousness paradigmeinsteineric weinsteingrittologyjewish conspiracyjewish structureslicense to offendontological paradigmontological realityquantum computers
00:38:26
2024 - October (14)
24 Oct 2024 Thu
Clif High / NOTIFICATION From Universe
#zero point energystephen greersolar energyalien interventioncourtney browndavid wilcockdick algierdonald trumpeconomic disruptionelohim worship cultfarsightfossil fuelsfuture forecastingfuture forecasting groupjoe roganremote viewingschumann resonance
00:53:28
24 Oct 2024 Thu
Clif High / Notification from UNIVERSE.
#zero point technologystephen greerschuman resonancealien contactchemtrailsconsciousness theorycourtney browndick algierdonald trumpelohimfarsightfuture forecasting groupingo swannjoe roganlocal consciousnessmichael persingerremote viewing
00:53:28
23 Oct 2024 Wed
Clif High / Temporal Integrity Check
#zero point energyufosteslaclimate changeclimate change denialconspiracy theoriesdick algierdonald trumpelectromagnetic pollutionhaarpjewish financial interestsjoe roganmichael persingerremote viewingschumann resonance
00:55:16
19 Oct 2024 Sat
Clif High / Crouching Mollusk, Hidden Knights
#yoga sutrasufo phenomenastephen greerblack deathbruce leeconsciousness realityeternal nowfildo godluskiflux linerskarmalaw of attractionlombard jewsmayaontological modelspatanjalipleiadiansshin shin soitsu dostar trek prime directive
00:50:36
19 Oct 2024 Sat
Clif High / Crouching mollusks, hidden knights.
#ufo travel mechanicsspiritual awakeningshin shin soitsu dobig consciousnessblack deathcartesiansconsciousness realityeinsteineternal nowfildo godluskigrittologyhyperspacekarmakarma causalitylaw of attractionmateriumnormiesontological universepleiadians
00:50:36
15 Oct 2024 Tue
Clif High / 39 Days To Melee
#ufostemporal markerspsyopsakashic recordscharlie warddata processing methodsdepartment of defensedick algaierdonald trumpfifth generation wargeopolitical conflicthurrianigorjedujedugarjoe rogannuclear explosions
01:00:42
15 Oct 2024 Tue
Clif High / 39 Days to Melee
#ufo phenomenatemporal markersq dropsakashic recordsautonomous dronescharlie warddonald trumpfifth generation warfarehurrian languageigorintergalactic webjedujoe rogannuclear testing
01:00:42
08 Oct 2024 Tue
Clif High / Kozyrev's Toaster - Part 2
#zionist new world orderyuktasvarweather weaponsalien contactancient literatureascending bronze ageconspiracy theorieselohim worshipherd ownershillary rodham clintonkali yugamind controlnew world ordernikolai kozyrevtime mirrortime physics
00:30:42
08 Oct 2024 Tue
Clif High / Kozyrev's Toaster 1
#world economic forumweather warsmega sunsalien influencechannelersclimate controlconfirmation biascovid vaccinesgalactic cyclesgenghis khanherd managementhillary clintoninformation warfareislamkali yuga
00:26:10
08 Oct 2024 Tue
Clif High / Kozyrev's Toaster - Part 2
#zionist new world orderyuktasvarweather warfarealien disclosureancient literatureconstantineelohimeusebiusinformation warfarejanuary 2025kali yuganikolai kozyrevnovember 2024time consciousnesstime mirror
00:30:42
08 Oct 2024 Tue
Clif High / Kozyrev's toaster -Part 1
#world economic forumwolconianismspace aliensagenda 2030climate engineeringconspiracy theoriescovid jabsglobal governanceherd managementhillary clintonhistorical cycleshypernoveltykali yugakinetic weaponslithium miningmega sunsmind controlmk ultrapowers that be
00:26:10
07 Oct 2024 Mon
Clif High / First Principles Woo
#vimanasilicapure sleepalien abductionsanunnakicarrie cassidycatholic groupsconspiracy theoriesdavid seraitadevaseconomic collapseelohimfasciafemafreemasonsgovernment controlmelaninmind controlpineal gland
00:53:50
07 Oct 2024 Mon
Clif High / First Principles Woo
#vimanavaccine skepticismpure sleepalien abductionsalternative medicineanunnakicajun navycarrie cassidyconspiracy theoriesdavid seraitadevaselohimfemafreemasonsglobal governancejeff berwickmark richardsmoon stuff data
00:57:48
01 Oct 2024 Tue
Clif High / Welcome to the Maelstrom!
#yeshuaufo disclosureturbo cancersage of enlightenmentconspiracy theoriescouncil of nicaeadr jack cruzelohim worship cultemperor constantineeusebius pamphilusfinancial collapsegalactic cyclesjewish mafiakrishnamaelstrompolio vaccinesreligious historysimian virus 40sv40
00:54:38
2024 - September (14)
29 Sep 2024 Sun
Clif High / Improvisation! Not a good sign...
#zero point energyufosseed oilsbioweaponschaga teaconspiracy theoriescovid 19deep stateeconomic collapsefederal reserve notehigh fructose corn syrupivermectinjay widenerjean claudekhazarianspsyop
01:02:04
22 Sep 2024 Sun
Clif High / EPN
#vernadskyvedic religionstime travelabrahamic religionsalien abductionscommunist jew takeoverconspiracy theoriescorey goodeinsteinian hoaxgenetic experimentationhuman dnajapanese yogajohn titerkozy revpersiaquantum physicsreligious hoaxesspace aliens
00:32:56
18 Sep 2024 Wed
Clif High / Idiots.
#ufosnormiesnoahbiblebible criticismbinary thresholdsconspiracy theoriescritical thinkingcrustal pole shiftselohim worship cultextraterrestrial lifefreemasonshealth rangeridiotsjesuitsmike adamsmoses
00:54:04
15 Sep 2024 Sun
Clif High / Woo Who?
#zero point technologysocietal restructuringshungitealien contactconspiracy theoriesdeep statediscontinuityelectromagnetic radiationelohimjesuitsmasonsnon gravitational physicsnuclear warreligious conflict
00:30:04
15 Sep 2024 Sun
Clif High / FREQ them OUT!
#zptzero point energyshungitealien contactcatholic churchdeep stateelectromagnetic radiationelohimglobal discontinuityjesuitsmasonsproject blue beamreligious declinereverse engineered alien physics
00:30:04
13 Sep 2024 Fri
Clif High / Make-a-way! Period.
#zeta reticulanswu crowdufo technologycircle of certaintyconsciousness evolutionconspiracy theoriescorey goodediscontinuityforced decentralizationhyper noveltymake a waynormiesspace alienssystemic collapseufo disclosure
00:14:32
12 Sep 2024 Thu
Clif High / What are we missing?
#stephen greerrumblepsychic capabilitiesalien interventionanunnakibeyondmysticnetcarrie cassidycharlie wardchemtrailsconspiracy theoriesdeep statedevaselohimhypothalamusjean claudemark richardsmelanin systemphil do godluski
00:46:59
09 Sep 2024 Mon
Clif High / The Aard Corps
#zazenvipassanavaccinesbiohackingeternal presenteye mudramanifest realitymeditation techniquesmindfulnessneuroplasticityno thoughtpsychosomatic wellnessseed oilseizaundiscovered country
00:32:30
09 Sep 2024 Mon
Clif High / The Undiscovered Country
#wafoniansundiscovered countryseven seals of the biblecatholic churchconscious manipulationelohim worship culteternal nowevangelical pastorsindependent meditationmagi from persiamasonic allusionsmystery schoolsprotestant churchesrabbinical councilsreligious control
00:08:56
08 Sep 2024 Sun
Clif High / Bitchin...AI
#wifoniansturing testtom campbellartificial intelligencecarrie cassidychemtrailsconspiracy theoriesdavid adairdinar scamsdisinformationfear pornlarge language modelsmark richardsmother weversnasara gasaraqfssecret space programs
00:36:34
08 Sep 2024 Sun
Clif High / Bitchin...RE
#synagoguessuper major emotional releasereal estate crashcadillac escaladecanadadeep statedeep state agendaindigenous populationsindigenous rightsjean claudejewish peoplemexicomigrantsnorth americanorth america economyproperty valuations
00:41:34
06 Sep 2024 Fri
Clif High / How to Pee........................!
#zen buddhismvipassana meditationufo disclosurealien contactcathari hymndick algaierjapanese yogajoe dispenzalaw of attractionmeditation practicesmind controlnakamura tempu senseishin shin soitsu aikidospiritual enlightenmentstephen greer
00:43:38
05 Sep 2024 Thu
Clif High / How to PEE....................................................................!
#vipassana meditationufo activitystephen greeralien contactcathari hymnconsciousness trainingcryptocurrency trendsjoes predictive dreaminglas vegas conventionlaw of attractionmartial artsmind controlnakamura tempu senseishin shin soitsu aikidospiritual enlightenment
00:43:38
01 Sep 2024 Sun
Clif High / New Cult on the Block
#zero point energywhite racesub saharan africansalien abductionsanti semitismconspiracy theoriesee systems deviceselohim worship cultfake alien invasionglobal resetgreat resethyper noveltyklaus schwabnew age beliefsnuclear warreligio techno cults
00:50:29
2024 - August (9)
24 Aug 2024 Sat
Clif High / Release the Psoas!
#whistleblowerwarrior 2 yogaufosaugust 27thchina bank collapsescortisoldiaphragmic breathingelohim worship cultfinancial collapseglobal momentum shiftgreat awakeninghuman consciousnesspsoas musclesstudent loan debtstudent loan forgivenessuap disclosureuaps
00:31:11
21 Aug 2024 Wed
Clif High / Time grammar
#yuktasvarufo technologytime travel physicsancient historyconspiracy theorieseinsteinelohimgalactic centerhindu yugashuman biologyjason georgianaimagnetic pulsesout of place artifactspineal glandsungazing
00:44:48
19 Aug 2024 Mon
Clif High / Consciousness
#space aliensremote viewingquasi crystal superconductorancient extraterrestrial contactanunnakicarbon based slaveschaitanyaconsciousness ontologycrystals and timeelohimkozyrevmelaninpleiadians
00:53:32
18 Aug 2024 Sun
Clif High / UFOs meet & greet...
#vietnam warufo sightingsufo phenomena10th mountain divisionblue lightcircadian rhythmsconspiracy theoriesdeep statedougee systemseinsteinian modelelectromagnetic radiationemfmacmilitary healthsalt polio vaccinesscalar wavesscalar wave therapy
00:45:08
13 Aug 2024 Tue
Clif High / The Discontinuity
#zero point technologyufosuaps5g interferenceai controlled medical devicescoastal currentsfinancial systemsgalactic energiesjet streamskali yugalightning eatersm9 pointmed bedspolitical upheavalqfsrife technologyuap phenomena
00:57:49
07 Aug 2024 Wed
Clif High / NOYZE!
#systemic noisereggie middletonreconquistabitcoincentral bankingconspiracy theoriescryptocurrencydat tapesdick algierelohim worship cultfinancial collapsefuture forecastinggalactic centerm9 pointmental judomental stability
00:32:13
05 Aug 2024 Mon
Clif High / Smackeraled normies!
#zionist supremacywafoniansukrainealien cardbiden regimecontention dichotomycorporatistdeep stateeconomic collapseelohim worship cultexopoliticsextraterrestrialsglobal conflictiranisraelmedia manipulationmental judonorth korea
00:16:41
03 Aug 2024 Sat
Clif High / Ship of Monkeys
#zero point energyvaccinationtechnological disruptionawake communitybitcoinconspiracy theoriescultural warsdat tapesdeep stateextraterrestrial lifefiat currencyfinancial collapsegalactic center energiesgeopolitical conflictiranian generalisraeli forcesmoon whistleblowernew gold schemenormiesship of monkeys
01:01:21
01 Aug 2024 Thu
Clif High / changes
#rehabilitation centerreferential integritypacific coastaudio productionaudit trailaugust 1data archivingdat tapeselderly carehealth criseshome hospitalmetadatanursing careoxygen needs
00:07:46
2024 - July (5)
24 Jul 2024 Wed
Clif High / Break-away.
#zero point energyufo disclosuresmith mundt actage of aquariusbreakaway civilizationcatherine austin fitzconspiracy theoriescorey goodedark journalistdavid wilcockdepartment of defensegaiagovernment projectslahaina firesrichard dolan
00:44:29
20 Jul 2024 Sat
Clif High / Ontological Aliens
#xrp qfssecret space programsoppenheimerabraham lincolnalien interventioncarrie cassidyconsciousness and souldavid wilcockeinsteinelohimfeynmanmark richardsnasaranuclear weapons theoryontological framework
00:45:46
20 Jul 2024 Sat
Clif High / Language and circumstances...
#space aliensremote viewingqfsancient greekbitcoinblackrockconspiracy theoriesdick algierdonald trumpelohimglobalism declinehebrewjew dystopialinguistic determinismnasara gasara
00:39:48
08 Jul 2024 Mon
Clif High / Complex understanding
#weinstein brotherswalter russellquantum consciousnessanti reductionismbrett weinsteinbuckminster fullerconsciousness realitydick allgaiereinsteinian physicseric weinsteingrittologylarge hadron collidermateriummeat suitsontological physicsplacebo effect
00:38:38
08 Jul 2024 Mon
Clif High / The other physics
#ufosufo physicstalmudblack tuesdaybrian keatingconsciousness firsteinsteinelohim worship culteric weinsteingritologykatalin karikólarge hadron collidermartin armstrongmrna vaccinespatent corruptionpermanent magnetsreverse engineered alien craftstock market crash
00:26:34
2024 - June (4)
30 Jun 2024 Sun
Clif High / Economic Ecology of the ELohim
#sky councilpopulist revolutionnormiesage of aquariusalien conquest theoryancient history revisionismantarcticaanunnakiatlantiscrackup boomeconomic collapseelohimfourth turninggonskali yugamatrixnarrow dimenoahs ark
00:33:19
25 Jun 2024 Tue
Clif High / WTF? Eh? 7/15
#ufosremote viewingrabbinical councilsbiden regimeclimate changeconspiracy theoriesdepartment of defensedick algierelohim worship cultfinancial marketsflat earth theoriesfuture forecastingisraeljulian assangejune 15thjune 16thkinetic events
00:26:10
07 Jun 2024 Fri
Clif High / 90% gone missing!
#yahwehrené descartesquantum physicsacademic sciencealternative medicinebrett weinsteincartesian dualismcartesian spaceconsciousnessheather hayingkey energymed bedsmel carneinpranaqfsqiquantum financial system
00:33:11
07 Jun 2024 Fri
Clif High / Immunity...
#yahwehwefwaconiansadjuvantsbird flublack deathconspiracy theoriescovid 19germ theoryimmunologyjewish identitykhazarialucifermedical censorshipnuclear warrockefellerspanish flutalmudic jewsvaccine skepticism
00:42:24
2024 - May (12)
31 May 2024 Fri
Clif High / It's systemic...
#yuktasvarwalter russellterrence howardbrett weinsteinbuckminster fullerconsciousness studiescorey goodeenergy realityeric weinsteingrittologistsjames keelyjean baudrillardkarma systemsken schwartzlaw of attractionmaterialism critiquemoxifusionpeter thielreligious diversity
00:26:55
31 May 2024 Fri
Clif High / Very Large Scale Effects
#who pandemic treatyuniform commercial codetwitteranti semitismartificial intelligencebrett weinsteincarrie cassidychemtrailsclimate change skepticismconspiracy theoriescorey goodelegal strategynerve 11nerve 9peruski speaking fellowsscott perezsocial media censorship
00:34:10
24 May 2024 Fri
Clif High / Complex vs complicated
#walter russellterrence howardsynergeticsbuckminster fullercartesian thinkingclimate change agendascoanda effectcomplexity theoryjoe roganjohn keighleypatent litigationreggie middleton
00:40:18
20 May 2024 Mon
Clif High / Choose YOUR future flavor...
#zionist nuclear warsocial credit systemreal idalien disclosurecbdccentral bank digital currencydeep stateelohim worship cultepstein client listgeneral flynngeorge sorosnuclear warpetrodollarpetrodollar collapse
00:26:00
18 May 2024 Sat
Clif High / Detox Aluminum
#wheat germ oilvitamin supplementationvitamin ealuminumaluminum detoxificationchemtrail conspiracychemtrailsclimate deniersconspiracy theorieselohim worship cultheavy metal chelationhemochromatosisip6modified citrus pectinpectinvitamin c
00:09:12
18 May 2024 Sat
Clif High / Defend your hippo!
#pineal glandpetrodollarmkultra5g frequenciesalex jonesaluminum oxideamygdalaatlantisbaby boomer generationchemtrailsconspiracy theoriesdr carl rogerselon muskhippocampusjan halper hayesmelatoninmemory manipulation
00:52:20
17 May 2024 Fri
Clif High / DEFEND YOUR HIPPO!
#rife machinemind controlmemory manipulation5galex jonesaluminum oxideatlantiscarl rogerschemtrailsconspiracy theorieselon muskfiat currencygender identityhippocampushypothalamusjan halper hayes
00:52:20
17 May 2024 Fri
Clif High / DEFEND YOUR Hippo
#strontiumsocial securitypineal gland5g technologyalex jonesaluminum oxidebariumcarl rogerscesiumchemtrailsconspiracy theorieselon muskhippocampushypothalamusmemory manipulationmkultranpcs
00:52:20
14 May 2024 Tue
Clif High / Time is not complicated, it is complex.
#zoharwolconianismvaticanalien abductionsbig pharmabrian keatingconspiracy theoriescovid 19 pandemicelohimjewish persecutionkali yugaphariseesreligious extremismtalmudthalidomidevaccine safety
00:23:11
13 May 2024 Mon
Clif High / Drone season opening up
#vatican apparitionssocial security payoutssalk polio vaccinecharlie wardchemtrail awareness monthchemtrailsconspiracy theoriescovid 19 originsdeagle sitedepopulation plotelohim space aliensfaa authorityfiat currency collapsegasarahamasmedbed scammersmedia manipulationnassera
00:19:36
12 May 2024 Sun
Clif High / Simple Authority
#vaticanspace aliensscientific skepticismalien contactaurora displaysauthoritarian structuresbird flu pandemicchemtrailsclimate crisiscomplex systemsconspiracy theoriesgalactic centerjunk dnam9 thresholdreligious prophecy
00:21:04
11 May 2024 Sat
Clif High / Complex Errore Yupgryeds
#zoomzionismvladcivilization transitioncommunismcomplex systemsculture wardeidumbbell shaped centerelohimfailing ideologiesgalactic centergolden agekali yugam9 pointmilky way galaxyplasmoid fieldssocialismsolar flares
00:24:51
2024 - April (7)
24 Apr 2024 Wed
Clif High / Muddy Waters
#ufo researchjewish controlhyper noveltyalbert einsteinbond market crashchemtrailscoal fly ashconspiracy theorieseconomic collapseeisenhowereric weinsteinfake holocaustgalactic centerholocaust denialhyperinflation
00:29:50
24 Apr 2024 Wed
Clif High / Phi
#zero point energyvibration frequencytime perceptionanti gravity technologyaristotleconsciousness manipulationelohim worship cultgolden ratiomateriumnikola teslaphiplatonic solidsprimary magnetismsacred geometry
00:31:44
18 Apr 2024 Thu
Clif High / Will Tonga Rule the World?
#uapstongasolar flaresartificial intelligencec 130chemtrail awareness monthchemtrailscomputer chip failuresdeep statedeep state corporationseurasiagazajudassocsolar events
00:27:18
11 Apr 2024 Thu
Clif High / Propagandists' Shuffle Danz.
#world economic forumtruth in advertising lawstransgender actorsanthony faucibill gatesbo burnhamchemtrail debateschemtrailsconspiracy theorieselohim worship cultgeorge sorosglobal governancegold eaglesgreat resetmedia manipulationnasasocial unrest
00:26:16
11 Apr 2024 Thu
Clif High / Justice vs Law.
#vigilante justiceufo documentssocial unrestbill gatesblack tuesdayconspiracy theoriesdual citizenseconomic collapseelohim worship cultfaminejewish leadershipklaus schwabmass deportationsnew york cityreligious persecution
00:26:52
06 Apr 2024 Sat
Clif High / Your Map of Contention
#war industryuapstaoismaikidobrain mappingcontention homunculuscortical homunculusenergy sciencefrancisco shaw katarahomunculushuman growth hormonekey forcelife forcemorihei ueshibamotor homunculusneuroscienceosansepopulation control
00:35:07
06 Apr 2024 Sat
Clif High / Your Map of Contention
#ukraine conflictuapspopulation reductionaikido practicebankersbrain homunculusconsciousness and conflictcortical homunculusfrancisco shaw katarageopolitical conspiracyhuman population reductionkey forcemotor homunculus
00:35:07
2024 - March (6)
19 Mar 2024 Tue
Clif High / Normie Krazie
#world economic forumvon misesvaccine safetybabylonian talmudchemtrailscommon law courtsconspiracy theoriescryptocurrenciesdeagle numberseconomic collapseglobal governancemental health crisismrna technologyphariseesseed oils
00:27:47
19 Mar 2024 Tue
Clif High / Cancer & chemies
#urolithin atocotrienol vitamin ethiaminealternative medicinec60 fullerenescancer treatmentchemtrailscoal ash wasteconspiracy theoriesfenbendazolefenbendazole protocolivermectinnatokinaseplasmalogensspike proteinstage 2 colon cancer
00:33:41
15 Mar 2024 Fri
Clif High / Self revealing
#zero point energysurveillance statenuclear weaponscbdcconsciousnessdead end grit aggluteration physicselectrocultureelohim worship cultfoundriesfourth industrial revolutionklaus schwabmulti mineral amalgams
00:24:28
15 Mar 2024 Fri
Clif High / Plasma & Shit
#sumerian languagerichard feynmanrelativity theoryakkadian languagealbert einsteinamorite languageancient astronautscanaanite languageegyptian languageelectric tether experimentelohimelohim mythologymichelson morley experimentmosesnasanasa researchphoenician languageplasma beingspre life entities
00:26:24
08 Mar 2024 Fri
Clif High / ZPT for You and Me
#zero point technologyzero point energyworld economic forumchild traffickingdirected energy weaponselohim worship cultfederal authoritiesglobal revolutiongovernment conspiracyintelligence agenciesjesus sacrificejewish organizationsmind controlproto hebrew hymnssanskrit hymnsufosufo sightings
00:26:23
08 Mar 2024 Fri
Clif High / Dramedy at TWC corral
#wellness companyunited nationstartariaalternative mediabadlands mediacentral bank money printingconspiracy theoriesdeep stateeconomic collapseelohim worship cultfoster coulsonglobal politicsharp projectintelligence industryivermectinjimmy doresarah westallsean at sgt report
00:28:23
2024 - February (16)
28 Feb 2024 Wed
Clif High / Face Value...
#tens unitsshungitesandrabiophoton reflectioncopper based peptidescrackup boomee scalar wave deviceselectromagnetic radiationfinancial collapsehyperbaric oxygen chamberslightwave patchesmulti level marketingmultiple sclerosisphil godlskiplacebo effectpseudoscience critiquered light therapy
00:26:09
28 Feb 2024 Wed
Clif High / Kondratiev's Revenge
#wealth transfersocialismsilver pricebank reservesbitcoinbitcoin price predictioncommercial real estatecommercial real estate crisiscommunismeconomic degradationeuropean unionfederal reserve notefiat currencyfiat currency collapsekinetic activitypetrodollarpetrodollar system failure
00:34:18
27 Feb 2024 Tue
Clif High / Long Day, Busy Year
#world economic forumufo sightingtalmudalien abductionsbitcoinciaclimate crisisconspiracy theoriescryptocurrencyeconomic collapsefederal reservegazaglobal chaosjewish organizationsparvopolitical unrest
00:40:29
23 Feb 2024 Fri
Clif High / Energy, in old age & with cancer...
#urolithin aturning frogs gaytonkadalialex jonesamerican revolution 20anti aging strategiesc60cancer recoverychaga teachemtrailsconspiracy theorieselohim worship cultmitochondrial healthplasmologenssarcopeniatestosterone decline
00:21:53
23 Feb 2024 Fri
Clif High / Judgement...
#thimerosalsecret space programssalt polio vaccinecharlie wardcolon cancerconspiracy theoriescorey goodeflat earthfraud exposedjan halper hayeskerry cassidylegal strategymedical safetyphil godlskipublic credibilityrabies vaccinerico charges
01:01:25
23 Feb 2024 Fri
Clif High / College vs Trade school?
#zinc poisoningtrade schoolsstudent loansapprenticeshipscommercial real estatecommercial real estate crisisconspiracy theoriescopper blooddoctorseconomic viabilityelectricianelohimfrankincensemedical careersmedical residentsmerchant marineplumbingstudent loan debt
00:43:07
18 Feb 2024 Sun
Clif High / A clonez' life...
#william tompkinsreligious conflictpolitical persecutionalbert einsteinbitcoinclinton foundationconspiracy theoriescryptocurrencydan burrishelohim worshipfinancial marketskerry cassidyking james biblemark richardsmoneronikola teslaphil godluski
00:34:35
18 Feb 2024 Sun
Clif High / Painful...
#zimbabwesg anonquantum financial systembitcoin economicscharlie wardconspiracy theoriescorey goodecryptocurrency scamsentheosfinancial crisisgene decodegessaralou gehrigs diseasemedbedsnasaraphil godlooskiqfs
00:55:10
18 Feb 2024 Sun
Clif High / Stacking...
#witchcultufo disclosurereligious revivalantarcticabitcoinbitcoin remodelingcarnivore dietcernconspiracy theorieselohimfederal facilitiesglobal revolutionglobal revolution 1juanmedbeds
00:28:42
18 Feb 2024 Sun
Clif High / NDA
#stolen valorquantum frequency systemphil godlewskicharlie wardcorey goodecorporate secrecyfraudulent narrativesgene decodegriftersintellectual propertymed bedsmicrosoft consulting servicesnon disclosure agreements
00:35:07
13 Feb 2024 Tue
Clif High / Chilled Aliens
#talmudreligious fabricationplatoantarctica basesazaralchinese communist partyconsciousness originscorey goodeelohimelohim worshiphuman animal hybridsjesusjewish dominationjohn kerryjuan osabanluciferiannew testamentphil godlewski
00:28:20
13 Feb 2024 Tue
Clif High / Clonez
#time compressionterry cassidysouth american tunnelsalien hybridsartificial wombscarrie cassidycloning scienceconspiracy theoriesdna memory storagegene d codegitmogray aliensphil schneidersoul and conception
00:33:16
03 Feb 2024 Sat
Clif High / Crack open the ELohim egg...
#world economic forumreligious collapsepolitical assassination9 11 attacksage of aquariusalien contactbill gateschristianityconspiracy theoriesdonald trumpelohim worship cultgabrielislamisraeljudaismklaus schwabnew age movementpatriot network
00:25:37
03 Feb 2024 Sat
Clif High / Infighting...
#world economic forumweftrumpalternative mediabitcoinborischarlie wardconspiracy theorieseconomic collapseeuropean unionfbifebruary 18thfinancial hedgingjimmy savillejoe bidenleptomacronphil godlewskipolitical upheaval
00:59:04
03 Feb 2024 Sat
Clif High / Investments....
#wafonian communiststrumprothschildsantifabill gatesbricscharlie wardconspiracy theoriescorey goodecryptocurrency collapseelohim worship cultgeopolitical conflictjewish mafiakerry cassidykhazarian mafiaphil godlskireal estate marketreligious extremism
00:20:31
03 Feb 2024 Sat
Clif High / Anon Authors...
#yahwehvaimanispace navigationai translationancient technologydark spectrumelectromagnetselohimflying machineslavenderlevitationmagentamercury spinningocr limitationsrussian textssanskrit bookssanskrit literature
00:40:29
2024 - January (11)
27 Jan 2024 Sat
Clif High / Emotional Burden
#william tompkinsufo phenomenasocial collapseanalog computing revolutionconspiracy theoriescorey goodeelohim worship culthyper noveltyjan harper hayesmark richardsmass suicidemauro biglinomental health crisisnormiesorganic manufacturingself organizing collectivesoc
00:26:39
27 Jan 2024 Sat
Clif High / It's ALIVE!
#raytheonmedia collapselockheed martin9 11 attacksamerican revolutionamerican revolution 2artificial intelligencebuzzfeedcaptain mark richardschatgptconspiracy theoriesdeep stategovernment corruptionjay weidnerjean claude trotierkali yugakerry cassidy
01:09:33
27 Jan 2024 Sat
Clif High / Trivivium
#william tompkinstrivium educationtrivium9 11 conspiracy theoriesatlantiscarrie cassidyconspiracy theoriescritical thinkingdeep fakesdustin nemoelohim worship culthistorical revisionismholocaust denialjeff berwickjfk assassinationmark richardsmedia literacytorah timeline
00:43:24
23 Jan 2024 Tue
Clif High / AI & Bullshit
#soap bark treesentient aiquillaja extractalien aianimal healthartificial intelligencec60 purple powercbd regulationconsciousness debatesgene decodegreen revolutionindex based search enginekerry cassidylegal disputesneural nodes
00:41:22
20 Jan 2024 Sat
Clif High / Corp Wars !
#whistleblower authorityufosstrategic violenceai developmentcaptain mark richardscarrie cassidyconspiracy theoriescorey goodcorporate autonomyelohimgene decodegovernment dissolutionhyper noveltylockheed martinraytheon
00:22:52
20 Jan 2024 Sat
Clif High / Untethered Heathers
#ufostucker carlsonstockholm syndromealien conspiracy theoriesbeau polnibrett weinsteincontrolled oppositionelohimheather weinsteinhyper noveltyinfluencer manipulationnarrative controlnormie shockreligious authority crisissocial disorder
00:27:05
17 Jan 2024 Wed
Clif High / Hyperspace and Time.
#vietnam veteranufo phenomenatime crystalsbasharbitcoincarrie cassidychannelingconsciousness studieseinsteinian relativityelohimextraterrestrial conflicthyperspacejoes airplane crashmescalinemicrodosingpsychedelic experiencesreptilian beingsringmakersrpg attack
00:37:19
11 Jan 2024 Thu
Clif High / SOC vs TEAM
#whowefunacademic corruptionbiden regimebrett weinsteincolonel yahwehconspiracy theoriescovid measuresdeinstitutionalized academicsdepopulation agendaelohim worship cultgender studiesgovernment authorityhyper noveltyirslord yahwehpeer reviewed science
00:35:04
11 Jan 2024 Thu
Clif High / Symptoms
#teslastockholm syndromesnoqualmie falls passabrahamic religionalien abductionsanunnakiapril 3rdbrett weinsteinconspiracy theoriesdeep stateeinsteinelohimjewish historymental health crisisquitoreligious critique
00:29:51
03 Jan 2024 Wed
Clif High / Speculation vs Investment.
#sound moneysilverreverse engineered technologyalien technologybitcoinbricsbrics nationsbuffalo genocidechinaeconomic cyclesfiat currencygold beanshenry fordhyperinflationjoemother wefersnative americans
00:38:25
03 Jan 2024 Wed
Clif High / SciFi World
#washington state revolutiontitanic sinkingsound money economyamerican empireamerican empire collapsecrackup boomeconomic hyperinflationelohim worship cultfederal reservefederal reserve conspiracyfiat currencygang stalkinggang stalking claimshyper noveltykidney treatment drugsmithsonian institutionsocietal breakdown
00:27:14
2023
2023 - December (8)
28 Dec 2023 Thu
Clif High / Crack up boom JUST AHEAD in 2024!
#uss libertyunidentified aerial phenomenaprophetic dreamsbo polonycentral bankingcommercial real estateeconomic collapseelohim worship cultfebruary 18thgold investinggold panninghyperinflationkerry cassidykhazarian jewnikolai kondratiev
00:27:47
28 Dec 2023 Thu
Clif High / Alien (you know which ones) cult.
#ukrainestockholm syndromescientologyalien abductioncivil warconspiracy theoriesdried baby flesheconomic collapseelohim issuesgenocidehuman blood productshyperinflationillegal occupationjewish identitypalestinepolitical extremismrafi faber
00:32:37
20 Dec 2023 Wed
Clif High / Fed's shoveling that shit
#xrpstudent debt forgivenesssilverbidenbitcoinconstitutional moneycostcocryptocurrency marketseconomic collapseelohimfederal reservefederal reserve policygoldinflation theoryjoe
00:29:20
20 Dec 2023 Wed
Clif High / Damn space aliens...
#yahwehufo disclosuretalmudakkadiansalien deitiesbook of danielbo polneycanaanitesconspiracy theorieselelohimjewish bankersjewish bankingking james versionmercury retrogrademichaelreligious cults
00:31:33
13 Dec 2023 Wed
Clif High / Artificial Intelligence is retarded.
#woodpeckerstock market analysisrehypothecated stock certificatesagiai hallucinationsartificial general intelligenceartificial intelligencecarrie cassidyderivativesfiat currencyfoxlarge language modelsneural networks
00:31:08
13 Dec 2023 Wed
Clif High / More Elohim shit...
#zinc lined mugsyoga sutrastorahancient aliensartificial intelligencechatgptconspiracy theorieselohimhyper noveltyjesus gmojewish historymind to machine interfacesmoon warprompt injectionreligious texts
00:34:29
06 Dec 2023 Wed
Clif High / Our UFO problem...
#xufosufo encounterselohimelohim conspiracyexodusfiat currency collapseglobal banking cabaljewish history originskozirevmillivolt levelsred seascenario 3south yementime manipulationtribes of judah
00:33:20
06 Dec 2023 Wed
Clif High / Cryptos, Crash, & duration.
#xrpweimar republicufo knowledge2008 financial crisisbitcoincentral bank digital currencyconspiracy theoriescozy revcurrency collapsedecentralized blockchaindeep stateelohimether psychicnessfiat currencykhazarian mafiamonero
00:29:13
2023 - November (12)
29 Nov 2023 Wed
Clif High / Sister Christian
#unufo phenomenasocial revolution2024consciousness shiftel elyonelohimelohim identitygmo humangreat global revolutionhyper noveltykali yugamid aprilreligious deceptionsister christian
00:28:08
29 Nov 2023 Wed
Clif High / HOA Nightmare...
#vax vaccinevaccine safetyufosconspiracy theoriescrypto adoptionfreecadgeopolitical conflicthoa ruleshousing accessibilityhyper noveltyisrael palestinejewish octopuskhazarian mafiamobility issuesoverwooreal estate marketsingle story houseufo disclosure
00:32:31
21 Nov 2023 Tue
Clif High / 6000 years in the making! GGR!
#yugasworld economic forumufosbiden regimeconspiracy theoriescovid 19economic collapseeinsteinelohimgreat resethyperinflationjanuary 6thkazarian mafiamedia corruptionmother wefersreligious decline
00:32:16
21 Nov 2023 Tue
Clif High / Ouch!
#zebitwittertwin towersbeyond mysticconspiracy theoriesdata analysisdavid ickedeep stateelon muskfalse flag eventsjean claudejoekhazarian mafiamax eganmedia censorshipseptember 11 attacksset theoretic math
00:30:45
15 Nov 2023 Wed
Clif High / El merda divina
#wu peopleufo phenomenonspace aliensabrahamic religionsai biaschatgptcnncouncil of nicaeaelohimforce fieldsgovernment collapsehyper noveltyjesusmosesmush head effectnormiesreligious crisissocial disruption
00:30:20
15 Nov 2023 Wed
Clif High / Temporal Concentrate
#water mass changestime concentratorsspiral aluminum mirrorsbig bang theoryconsciousness researchkozirevlead weight anomalieslittle bloop theorynature of timeparapsychologyprescient visionspsychic abilitiesquantum physicsrussian stateshamanic journeys
00:22:40
08 Nov 2023 Wed
Clif High / What a RUSH!
#world war ii victimswolconian mind virusukraine warbaby boom generationconsciousness transferdeath processintuituslahainanazi israelisnon binary conceptspast life memoriespast life regressionreincarnationshoshona
00:24:37
08 Nov 2023 Wed
Clif High / Antiselenite
#uaeskookumreverse speechalien abductionsconspiracy theoriesdepopulation agendaelohimetruscan languagegazaglobal financial systemsisraeljordan petersonkazarian mafialunar anomaliesmiddle east conflictmoon cratersmossad
00:36:55
06 Nov 2023 Mon
Clif High / Near Real Time PSY
#telepathytalmudian jewish dominationspace aliens2024 predictionbibleelohimether theoryhypothalamusingo swanjames clerk maxwelllarge hadron collidermind controlnikola teslareligious schismsscientific paradigm
00:32:03
03 Nov 2023 Fri
Clif High / Eve of Destruction
#space alienspost covid inventorspost covid era75 year cyclebill gatesdeep stategravityisraelkali yugakhazarian mafiamax eganparadigm shifts
00:18:49
01 Nov 2023 Wed
Clif High / In Yo'Face
#shungiteremote viewingreligious fraudadam and evealien contactanunnakiarccatholic churchcbdcconspiracy theorieseconomic collapseelohimingo swanjordan petersonkali yugakhazarian mafiamormon church
00:30:25
01 Nov 2023 Wed
Clif High / Fucking stalkers....
#telepathystalkingshungiteaustraliacovidelectromagnetic fieldsisraelmax egannew zealandnorthern russiapsychic abilitiesrelocationremote viewingrussian experiment
00:18:20
2023 - October (10)
25 Oct 2023 Wed
Clif High / Wide view Woo...
#xrptethersilverbiden regimebitcoinconspiracy theoriescryptocurrencydick algiereconomic collapsegoldinflationjcs beyond mysticjoe jsnip4micronovapenny kellyremote viewing
00:34:09
25 Oct 2023 Wed
Clif High / Freaky Deaky!
#us federal governmentremote viewingpenny kellyacademiaalternative scienceconspiracy theoriesdick algiereconomic hyperinflationflat earth theorygovernment collapsehyperinflationingo swanmainstream mediamoon conspiracynazi bases
00:35:46
18 Oct 2023 Wed
Clif High / Lunatics never look up!
#selenite societyrothschildreligious declinecatholicismcivilization collapseconspiracy theoriesdavid dubinedavid ickefiat currencyfinancial crisisharappan valleyhollow moonhyper noveltylooshlunar mysticismmormonismpluto retrograde
00:30:51
15 Oct 2023 Sun
Clif High / blind horus eye
#spiritual awakeningsolar eclipseshizandraadaptogensancient aliensanunnakichaga teaconspiracy theorieselohimeye of horushorushypernoveltyhypothalamus functionkali yugakazarian mafiaoctober 14thquantum consciousness
00:35:10
14 Oct 2023 Sat
Clif High / blind horus eye
#solar eclipseshizandramind to machine interfacesadaptogensancient aliensbabylonian talmudchaga teaconspiracy theoriescortisolegyptian pantheonelyoneye of horusgalactic stressgreek godshindu godshypernoveltyhypothalamus functionkali yugakazarian mafiametaphysical models
00:35:10
11 Oct 2023 Wed
Clif High / Universe Punctuates!
#ukraine warrothschildrockefelleranti semitismashkenazi jewsconspiracy theoriesdeath campsfiat moneygas chambersgenetic studieshamasholocaustholocaust denialjudeanskazarian mafiakhazarian mafia
00:28:46
11 Oct 2023 Wed
Clif High / PsyFi World
#time perceptiontelepathyspace aliensapril 3rdcomputer time slicingconsciousnessegyptian knowledgeeinsteinhyper noveltyingo swankali yugakazarian mafiapsychic energy
00:29:56
04 Oct 2023 Wed
Clif High / Personal Discipline
#uni party speaker of the houseukraine money launderingreptiliansage of aquariuscentral bankingchemtrailsconspiracy theoriesdepopulation agendafederal reservehyper noveltykazarian mafiamartial artsmedia censorship
00:29:20
04 Oct 2023 Wed
Clif High / Happy Trails...
#ufo trackingstrontiumsmith and wessonadhdaluminum saltsalzheimersbariumbrett weinsteincesiumchemtrailsconspiracy theoriesdepopulation agendaevergreen state collegeheather hangmale fertility declinemale sperm productionneutrinospuget sound
00:32:01
02 Oct 2023 Mon
Clif High / woo globules
#zombie apocalypsevaccine safetysleep optimization5g5g technologyconspiracy theoriesemergency broadcast systemgabahuman growth hormonemelatoninmicrowave extractionnanoparticulate lipidsoctober 4thpineal glandpure bulkpure sleep
00:41:13
2023 - September (10)
27 Sep 2023 Wed
Clif High / Sync You...
#september 27thseattleroman empireaberdeen hoquiam rain derbyalternative mediaatmospheric riverconspiracy theoriesgalactic equatorial planehuman synchronizationjean claudekazarian mafiaolympiapiezo crystalline antennaepsychic evolution
00:28:51
27 Sep 2023 Wed
Clif High / Splits happen...
#world economic forumwefturkey earthquakeagenda 2030arrival 1996charlie sheenclimate change hoaxconspiracy theoriesfiat currencyfiat currency collapsegalactic energy shiftshollywood movieshyperinflationjean claude van dammekali yugalahaina fireslibya floodsparadise fires
00:31:40
20 Sep 2023 Wed
Clif High / Carbon Chips!
#vaccinesvaccine efficacysystemic collapsealien abductionbeast systembiden regimebiophotonicsbiophotonscarbon computer chipscentral bank digital currencyconspiracy theoriesjack kraussmelaninmelanin functionmutating virusessanskritspace aliens
00:31:48
20 Sep 2023 Wed
Clif High / AIiiiiiiiiiiigh!
#us militaryremote viewingnino rodriguezartificial intelligencechina politicschinese communist partyclimate modelsespionagehuman behavioritalian resistancekhazarianskorean warmilitary strategy
00:29:10
16 Sep 2023 Sat
Clif High / World Changing event?
#woodrow wilsonvladivostokshungite9 11 attacksbig mikecheyenne mountainchristmas eve legislationconspiracy theoriesdenver airportdirected energy weaponseconomic collapsegovernment surveillancekazarian mafialahaina firesmarine corpsnavy sealsobamaremote viewing
01:15:09
13 Sep 2023 Wed
Clif High / Space Budo
#wefsean david mortonpredictive programmingalien contactbiden regimebudocarrie cassidyconsciousness evolutiongreysinterceptorinterstellar travelkali yugamartial artsnasanino rodriguezplanetary degradationpleiadians
00:31:09
13 Sep 2023 Wed
Clif High / Feliz día de los Extraterrestres
#zonaras hoteltor networktorahalien artifactsalien dayconspiracy theoriescryptocurrencydark web salesenricoextraterrestrial lifejoe tampakhazarian mafiala unammexican congressnormissql programmingtalmud
00:29:20
07 Sep 2023 Thu
Clif High / New Dews Wars
#world economic forumturkey earthquakemaui attack9 11antifaantifa groupsashkenazi jewsbill gatescabalcalifornia wildfiresconspiracy theoriesdirected energy weaponsfalse flag operationsformer president obamahawaii wildfiresilluminatikhazarian mafia
00:27:47
07 Sep 2023 Thu
Clif High / Kid Wars
#space alienssmith mundt actsecret waralien disclosureapril 3rdbiden regimecbdceconomic collapsekhazarian mafialahaina firelaser weaponspearl harborred pilled childrenschool shutdowns
00:37:13
05 Sep 2023 Tue
Clif High / Woo War?
#ufosturkeyoprahalien warfareblue housescabalconspiracy theoriesdeclassificationsdirected energy weaponshigh power microwaveshuckleberriesmaui firesmoon
00:15:37
2023 - August (13)
30 Aug 2023 Wed
Clif High / Woo-Hoo!
#wu zoneus military activityrumblebuckminster fullerconspiracy theoriescovid scamhyper novelty thresholdjean claudekhazarian mafialunar threatmedia censorshipmilitary consolidationnaradigmnikola teslaparadigm shift
00:31:23
30 Aug 2023 Wed
Clif High / Suffer the Yugas
#yugastampa joesocietal instabilityapril 3 2024banking systemsconspiracy theoriescryptocurrencydonald trumpfebruary 2024galactic radiationjean claudekazarian mafiamoon inhabitantsnovember 22 1963
00:28:39
24 Aug 2023 Thu
Clif High / Al2O3 is some tough shit!
#world economic forumsub millimeter wavessmith mundt actbill gatesboeingconspiracy theoriesdirected energy weaponseconomic collapsegeorge sorosglobal eliteklaus schwablockheed martinmaui attacknanometer wavesolympic peninsularacial warfareraytheon
00:33:17
24 Aug 2023 Thu
Clif High / Hypernovelty Fall
#stock market fraudsocial unrestschool system bankruptcyalien contactaudit stock marketsc60 purple powercrackup boomeconomic collapseeuropean refugee crisisgovernment overreachhindu governmenthyper noveltyken schwartzmarket manipulationmoon rover
00:32:12
23 Aug 2023 Wed
Clif High / All chaos, all the time...
#united nationstheoirothschild familyancient aliensatlantisbiden regimecartesian paradigmclimate change denialconspiracy theoriesdeep statedevazeconomic collapseelohimgreat floodhomo capensislaurentian ice sheetnew age philosophyralph groupraytheon
00:31:46
23 Aug 2023 Wed
Clif High / Import-a-white-guy
#world economic forumwhite populationwhite genocidebiden administrationdollar devaluationeconomic collapsefbi agentglobalist conspiracykazarian mafiaobama administrationplandemicracial iq statisticssleeper cellssmith mundt actsocial order decaysouth africaunited nations
00:38:48
22 Aug 2023 Tue
Clif High / Do you Mind?
#vagus nervesanskrit textspineal glandalien contactancient technologyavestabuckminster fullerchatgptcircumcision claimsconsciousness transfercorey goodedevasdick algaierelohimmind machine interface
00:49:08
16 Aug 2023 Wed
Clif High / Welcome to the Release Party!
#zoroastrianismtorahtime and realityancient textsbitcoincbdccentral bank controldecentralizationelohimhoquiamkali yugakhazarian mafianasaseattlespace alienstaoism
00:41:33
16 Aug 2023 Wed
Clif High / Heart Beat of Time
#yuga cyclessiberian gulagparticle physics3d printingcivil unrest predictiondwapara yugaeconomic collapsefiat currencygalactic centerkali yugakhazarian mafiakozyrevmaui land grabsnovelty theory
00:47:40
09 Aug 2023 Wed
Clif High / Psi ing Around...
#vagus nervous systemufostemporal mechanicsadrenochromealien encountersancient technologiesashkenazicircumcisionclairvoyanceconsciousness controlcranial nerve xdeep statedeep state narrativedevaselohimmind to machine interfacespsi activitypsi phenomena
00:31:42
09 Aug 2023 Wed
Clif High / PSI Future
#zoroastrian scripturesvimana spacecraftvagus nerveancient spiritual textsashkenazi controlauthoritarian controlcircumcisiondarwinian evolutiondeep statedeep state conspiracyevolutionary biologylockdownspatanjali yoga sutraspsychic abilitiespsychic phenomenataoist literatureufo disclosureufos
00:34:58
02 Aug 2023 Wed
Clif High / Old instruction set...
#yoga sutrastorah originstorahadamalien technologyancient textsconsciousness controldevasenlightenmentevejesuslk99mind to machine interfacesmosespatanjalispace aliens
00:26:09
02 Aug 2023 Wed
Clif High / LK-99
#yoga sutrasvaccine side effectssuperconductivityambient ionizationancient engineeringangkor watcancerconspiracy theorieskorean scientistslake 99 daylk 99lk 99 discoverypatanjaliroom temperature superconductorsanskrit
00:25:28
2023 - July (7)
27 Jul 2023 Thu
Clif High / Crack UP BOOM!
#ufo sightingsradiation healthnikolai kondratiev2026biden corruptionbitcoincentral banksconspiracy theoriescrackup boomcryptocurrencyeconomic collapsefiat currencyinterest rateskefirl gasseril rutheri
00:31:35
27 Jul 2023 Thu
Clif High / Space Bonds...
#wefvaticanufo disclosurebronze age collapsechristopher mellonconspiracy theoriescorporate sovereigntyindus valleykali yugamellon familymoon colonizationquransaturns ringsspace colonizationspacex
00:35:47
20 Jul 2023 Thu
Clif High / Hidden Space Aliens
#yoga sutrasvaimanatorahalien contactancient technologybrain structurecircumcision claimsgender biologymagnetic bubblemind to machine interfacepatanjalireligious textsspace aliens
00:38:45
20 Jul 2023 Thu
Clif High / Immediacy Data Summer/Fall
#world war iiius treasuryufo disclosureaugust 15thcensorship industrydeep statedutch governmenteconomic crisisfederal reserveimmediacy valuesjuly 20thkazarian mafialate night talk show hostsmilitary industrial complexspace alien technologytreason
00:29:13
05 Jul 2023 Wed
Clif High / Redheads!
#yuga systemtorahtartarian empireadam and eveancient historyconsciousness studiesdna manipulationindus valley civilizationindus valley floodjewish calendarnorth poleold testamentreligious textsrishisanskrit literaturesons of god
00:27:50
05 Jul 2023 Wed
Clif High / Macro behavior...
#the lreligious critiquered sea partingadrenochromeadrenochrome harvestingalien dominationchild sacrificeconspiracy theoriesindus valley civilizationjewish zionist dominationkali yugakhazarian mafiakhazariansnaked biblenarco planet
00:36:57
02 Jul 2023 Sun
Clif High / Dynamic Dayz Ahead
#world economic forumwhounalgeriaantifacaliphatecivil warcultural conflictdylan mulvaneyeconomic collapsefranceglobalist conspiracyimmigration policymoorspolandrothschildsweden
00:25:33
2023 - June (8)
29 Jun 2023 Thu
Clif High / El of a situation
#world economic forumufo disclosuretransgender issuesadrenochromebidenflationcentral bankingclimate change narrativesconspiracy theoriesdelawareelohimfiat currency collapsegenetic manipulationgoyimkazarian mafialmarylandmedia manipulationsix genderssolar flares
00:38:06
28 Jun 2023 Wed
Clif High / Crypto Summer
#weissfield mallweimar republicspace alien disclosurebitcoinbitcoin etfsbronze agecentral bankingcryptocurrencyeconomic collapsefederal reservefinancial conspiracyhilton hotelskali yugakazarian mafiamarket crash
00:33:37
21 Jun 2023 Wed
Clif High / emotional tension forecasts...
#woke policieswhounatfcentral banksconstantinecouncil of nicaeadeep statedeep state collapsediet statefinancial instabilityfree energy technologyglobal conflictkhazarian conspiracykhazarian mafiareligious originsstock market crashesuap disclosureuapsufos
00:29:17
21 Jun 2023 Wed
Clif High / aggressive cancers
#vitamin d3vaccine safetyseed oilsadjuvantsandy rooneybill gatescancer causescolonoscopyconspiracy theoriesgeorge soroshealth supplementsklaus schwabmedical misinformationmrnanatto kinase
00:23:58
14 Jun 2023 Wed
Clif High / Crispr Critters...
#zapper beltsseed oilsseed oil healthadam and eveafibalien contactbromelainconspiracy theoriescpap machinescrispr technologyelohimgene pairsgenetic modificationinner abdominal fatkali yugapeptinidesreligious dogma
00:37:58
14 Jun 2023 Wed
Clif High / Innovation fading away
#trump arrestseed oilsprussia gateacademic censorshipalien abductionsantarcticaconspiracy theoriescultural marxismhuman ranchingjewish holocaustkhazarian mafianeutrino detectorspeer reviewpolitical paranoia
00:36:17
07 Jun 2023 Wed
Clif High / Judge's nuts...
#world economic forumsimon parksreputation economybud lightcharlie wardconspiracy theoriescorey gooddavid ickedepartment of justicedylan mulvaneyfake secret space programgeorge sorosjoe roganlegal strategymax eganmedia declinepurebulkcompure sleep
00:31:35
07 Jun 2023 Wed
Clif High / Med Beds....ain't
#talmudic accountsimon parkspharmaceutical supply chainsalien technologycarrie cassidycharlie wardconspiracy theoriescorey goodecrisprdonald trumpfalkegene editingjim williemed bedspain managementpapaver somniferum
00:34:15
2023 - May (20)
31 May 2023 Wed
Clif High / Dead and buried.
#vikingssoul attachmentshoshonaaustraliansbluetooth identifiersburial customscryptocurrency private keyscryptocurrency storagecultural practicesdigestive firesegyptian pharaonic customsembalmingexodus from egypthindusindian yogiskhazarian mafiareincarnation beliefsshabbetai zevi
00:13:33
31 May 2023 Wed
Clif High / Problems....not just septic
#viet congvenezuelasocial unrestargentinadebt ceilingderivativesfiat currency collapsefinancial crashgeorge soroshyperinflationjanet yellenkhazarian conspiracykhazarianslubavitchnational debtschneerson
00:30:26
31 May 2023 Wed
Clif High / Busted....
#vaccine safetysimon parkssasha stonealternative historycharlie wardclinging consciousness cultconspiracy theoriescorey goodecovid vaccineseconomic collapseeric trumpgovernment surveillancegraphene oxidekali yugakerry cassidymar a lagomrna shots
00:31:30
29 May 2023 Mon
Clif High / Time is on my side...
#yuga systemsworld war iiworld war iciaclimate changeconspiracy theoriescyclical historyeinsteingalactic cycleskali yugakazarian mafiamegalithic formationsmemorial daytransgender issuestranshumanismufos
00:34:04
27 May 2023 Sat
Clif High / Dwapara Virtue
#yuga cyclesvibratory energytime manipulationantarcticabronze agecbdccozy reveducation reformeinsteinenergy transitiongalactic energykali yugakhazarian mafiascalar weaponssubharmonic vibrations
00:44:12
25 May 2023 Thu
Clif High / mother WEFfing Earth Changes
#world economic forumpsychic predictionsplanet xbaby planet earthbanda aceh earthquakebitcoin trendsclimate crisisclimate crisis narrativeconspiracy theoriesdata integritydata pollutionkhazarian lobbynibiru
00:19:24
24 May 2023 Wed
Clif High / Time Ain't Nothing
#time as dimensionquantum mechanicsplancks constantalbert einsteinconsciousness and matterdwapara ageeric weinsteingreat year cycleheisenberg uncertainty principleinterest bearing currencyjeffrey epsteinkali yugakhazarian mafiamarie curienikola kozyrevpasteur
00:42:54
24 May 2023 Wed
Clif High / Peaking over the Barrier
#vaccine safetyvaccinesplandemicadrenochromeantifaantisemitismbig pharmaconspiracy theoriescovid 19debt ceilingdepopulationebt card systemeconomic collapseglobal elite networksjeffrey epsteinjewish privilegekhazarian mafiamodernapfizer
00:34:41
17 May 2023 Wed
Clif High / Apocalypse takes a while...
#world economic forumufostectonic activitycensorshipconspiracy theoriesdow jonesearly awakerseconomic collapsefederal reservefood riotsglobal governancegreat resetjune 12thkhazarian mafiapolitical instabilitysocial unreststock market crash
00:27:59
17 May 2023 Wed
Clif High / Souvenirs for the normies...
#white supremacysweden conflictspace aliensbiden regimeconspiracy theoriescovid vaccinescurrency devaluationdebt ceilingeconomic collapsefbifood riotsgold based currencyjewish establishmentkhazarian mafiapolitical polarizationsocial unrestsoviet union collapse
00:31:06
16 May 2023 Tue
Clif High / Mind Tools...
#zen buddhismvipassana practicevipassanaconsciousnessegoemotional awarenesshouseholder meditationinadequacyjealousymanifest realitymeditation techniquesmind controlmind toolsprakritisamkhyasamkhya philosophysmall raft school
00:20:42
14 May 2023 Sun
Clif High / Chaos, Kontrol & Harmony
#wefufosteslaage of aquariuscatharicatholicismconsciousnessconspiracy theoriesconstantinedualismfree willget smartkapilakhazarian mafiamay 14threligion critiqueretroductionsamkhyasherlock holmes
00:27:06
13 May 2023 Sat
Clif High / Antigravity Peanut Butter Sandwiches
#ukraine wart townsend browntesla2020 electionalternative physicsanti gravityartificial intelligencechatgptdc generatordeterministic systemsglass capsulematerium modelmercury experimentsspinning mercury
00:22:42
11 May 2023 Thu
Clif High / Real money, real drugs.
#supply chain disruptionsound moneysilver standardbiden administrationconspiracy theoriesdeath industrydrug shortagesfentanylfiat moneyglobal credit collapsegold standardhealthcare crisisjewish bankerskhazarian mafiaopium poppiespetrodollar systemrichard francis burtonrockefeller institute
00:25:53
09 May 2023 Tue
Clif High / Stars shine
#unified geometryscalar weaponsrussian z forcescoriolis effectscosmologyeric weinsteinether theoryflat earth sciencegeneral relativityjoseph rogero voscovichkozyrevnuclear fusionquantum mechanicsredshift
00:29:03
09 May 2023 Tue
Clif High / Bad Narradigm
#zionism critiquezionismvaccine debunkingadrenochromeagenda 2030age of piscesamerican empireamerican empire collapseconspiracy theoriesdeep stateelohimfederal reservekhazarian mafiamac addressesmay 9thone world governmentrauchenrfid tagstorahun
00:26:50
08 May 2023 Mon
Clif High / After Empire: What?
#zionist bentukraineufo disclosureage of aquariusage of piscesage of taurusamerican empireamerican empire collapseantarcticabretton woods systemdebt ceiling crisisdonald trumpgreater israelgreater israel planguampetrodollarphilippinessoviet union
00:27:53
07 May 2023 Sun
Clif High / Don't say that about Charlie's clone!
#white hatssimon parksshungitecarbon 60 fullerenescharlie wardclimate policycontract lawelectric vehicleselectromagnetic field meterselectromagnetic fieldsinternal combustion enginesjay inslee
00:29:56
04 May 2023 Thu
Clif High / real AI
#world economic forumvaxsound moneyai adjudicatorsartificial intelligencechatgptconspiracy theorieseconomic stabilityfederal reservegraphene oxideinsect wingslabor market disruptionnatural language processingneural networksoctober 2021
00:48:30
01 May 2023 Mon
Clif High / Don't FREAK OUT!
#wefwashington state earthquakesprimal wateralta reportsbritish columbiaclimate change denialconspiracy theoriescoos baydesigner fluidsearth expansionfukushimafukushima radiationglobal coastal eventinter tectonic plate fluidslaurentian ice sheetpacific ocean anomaliespacific ocean hole
00:25:17
2023 - April (13)
30 Apr 2023 Sun
Clif High / Algiz
#white nationalismveterans todaytartarian historyalgizconspiracy theoriesdivine sparkesoteric symbolismjain religionkhazarianmilitary markingsnazi swastikaold englishreincarnationreligious practicesrussian military
00:32:54
28 Apr 2023 Fri
Clif High / Interspecies Fight Club
#veterans todayvegetarianismspace aliensalien abductionsancient historyanunnakiconspiracy theoriesdick algierdietary healthexodus from egypthomo capensiskhazarian mafiamelaninmelatoninmind controlomega 6 oilsred sea coastrockefeller family
00:34:48
26 Apr 2023 Wed
Clif High / True Fat
#trans fatty acidssoybean oilseed oilsamino acidsbacon fatcanola oilclarified buttercorn oilgold standardlardmelatoninmitochondrial repairmuscle spindlespetrodollar systemrapeseed oil
00:38:09
25 Apr 2023 Tue
Clif High / Parallelsprache
#walter benjamintucker carlsonpolitical firinganti semitismberliner zeitungconspiracy theoriesder stürmerdon lemonernst tollerfox newsgeorge soroshistorical analogiesjoseph rothjulius streicherkhazarian mafiaklaus schwabkurt choloskymedia censorship
00:29:20
24 Apr 2023 Mon
Clif High / True Costs
#transgender rightstesla vehiclessocial collapseabortion accessadrenochromeborder conflictscentral bankingcentral banking systemclimate crisisde dollarizationdemocratic partyfiat currencygold standardhyperinflation
00:33:29
21 Apr 2023 Fri
Clif High / The Alligator's Mouth
#us dollarscientific skepticismmetaphysical transition55 gallon canaquarius periodbioweapon injectionscomposting systemeconomic degradationeconomic implosionfinancial crisisglobal banking collapseherd mentalityjune turmoilkazarian mafiamay events
00:06:42
21 Apr 2023 Fri
Clif High / The Alligator....
#united nationsufo disclosureufo activityamerican empirebabyloniansbill gatescash only societyclam gunsclimate change denialclimate deniersconspiracy theoriescovid era closuresearth dayeconomic collapseglobal currency systemskhazarian mafiarazor clams
00:24:26
19 Apr 2023 Wed
Clif High / The difficult man
#world economic forumstudent debtrust beltbiden regimebill gatescaliforniacivil unrestclimate change denialclimate shillsconspiracy theoriesdemocratic party of americaeconomic collapseeco shillsfederal reservehitlerimfinflation
00:25:25
19 Apr 2023 Wed
Clif High / Worst Crash Ever
#transgender pridetranifasoviet empirebiden familyclimate engineeringclimate skepticismcorey goodscurrency degradationde dollarizationdeep stateeconomic declineenergy crisisfederal reserveglobal warminglegal system failuremikhail gorbachevnuclear plantspetrodollar systempolitical collapse
00:33:19
12 Apr 2023 Wed
Clif High / Great Expectations
#world economic forumpatty murraymind control9 11 attacksact blueage of aquariusclimate changecommunist infiltrationdemocratic partyevergreen state collegefederal reservefinancial collapseglobal governancekazarian mafialin biao
00:34:56
12 Apr 2023 Wed
Clif High / Political vision
#world economic forumwashington statetransgender rights15 minute citiesconspiracy theoriesebt cardseconomic collapsegeorge soroshillary clintonjay insleekazariansmother wefersmunchausens by proxypolitical corruptionrepudiation daysocial engineeringsociety of corporate executives
00:32:47
05 Apr 2023 Wed
Clif High / School of Dead Men
#woke ideologyufo sightingstime travel theoriesadrenochromeancient cave artashkenazi jewscernconsciousness studiesgeneral relativityhyperspacekhazarianskozy revpsychedelic experiencesquantum mechanicsquantum mechanics critiqueschool of dead menshamanic dosestalmud
00:40:44
05 Apr 2023 Wed
Clif High / Heavy Metal!
#weftrump effectsocial unrest1923 germany1960s france401ksbanking system failurebond market fraudccpchinese yuancurrency devaluationfederal reserve notefinancial collapsegeopolitical conflictnatoprecious metalspresident macronrehypothecation fraudsilver coinssocial security
00:29:19
2023 - March (11)
31 Mar 2023 Fri
Clif High / WHY Woo
#universal design patternstrump indictmenttime rule number sevenaikidocathariconsciousnessconsciousness as creatordmteinsteinhyperspacemateriummescalinemetaphysical hyperspacenovelty potentialtemporal mechanicstheory of everything
00:46:11
29 Mar 2023 Wed
Clif High / Linguistic Mucking About
#zionismyiddishvaimanai2050ancient alienschristian bibleconspiracy theoriesdevasessenesgoyimkhazarianskhazar mythologylinguistic evolutionold testamentproto hebrewreligious originstorah
00:35:17
29 Mar 2023 Wed
Clif High / Weapon of Choice
#world economic forumtransgender rightstransgender peopleblood brain barrierccp propagandachina invasioncommunist party of chinaglobal conspiracyglutathionehormone therapykhazarianslimpid nanoparticleslin biaomental health crisismrna shotsmunchausens by proxynatokinasepsychological warfarespike proteinstestosterone administration
00:31:34
21 Mar 2023 Tue
Clif High / Time kills Gravity.
#string theoryscientific fraudquantum mechanicsalbert einsteinalternative physicsanti gravity technologyanti semitismashkenazi jewsconspiracy theorieseric weinsteinether theoryfederal reservekhazarian mafiamichelson morley experimentnikola tesla
00:34:10
21 Mar 2023 Tue
Clif High / Atypical Spring & Summer.
#ukraine warnatokazarian mafiabarack obamabiden regimebill clintonbitcoinbitcoin price predictiondeep statedeep state conspiracydonald trumpfederal reservefederal reserve critiquefinancial collapsegeopolitical crisisgold and silverhillary clinton
00:33:48
14 Mar 2023 Tue
Clif High / Alien TOEs
#unified field theorysoviet unionsouth africaalbert einsteinalien disclosureanti gravity technologyanti semitismashkenazi jewsccpconspiracy theoriescontinuous creation destruction modelcovid mandatesenergy technologyeric weinsteinfaukeygovernment collapsekhazarian mafiamagnetism
00:26:10
14 Mar 2023 Tue
Clif High / NOT SMART
#world economic forumweaponized munchausens by proxyufo disclosureatmcentral bank digital currencyclimate change denialdynamic link librariesfinancial crisisgroupthinkicd 10july september 2024mother weferspi dayspace alienstransgender identitytwitter
00:30:39
13 Mar 2023 Mon
Clif High / MASS
#wpaweimar republictrump citiescccdeep stateeconomic collapsefederal reservefinancial crisishyperinflationjfk assassinationkhazarian mafiaorganic capitalismspace aliensstudent loan systems
00:47:36
10 Mar 2023 Fri
Clif High / The Ugly Bank
#xi jinpingworld economic forumus banking crisisblmenergy backed currenciesenergy backed currencyfederal reservefiat currency collapseglobal economic shiftgold backed rublesjanuary 6thkhazariansmrna injectionsmrna safetynad kinaserothschild bankspike proteins
00:23:37
10 Mar 2023 Fri
Clif High / Banking Ugly
#world economic forumtransgender issuesponzi schemebanking system failurecbdcclimate changeconspiracy theoriesday of ragefederal reservefinancial collapsegreta thunbergmother weferocean shores
00:25:18
07 Mar 2023 Tue
Clif High / Math & Psyops
#washington stateunified field theorytransgender rightsanti semitismccpchatgptconspiracy theoriesether mechanicsfdiagender affirming care lawsgeneral relativityhemochromatosisicd 10 code f6810kazarian mafiamao zedongquantum mechanicsquantum uncertaintysocial engineeringtensor math
00:34:31
2023 - February (12)
28 Feb 2023 Tue
Clif High / We all knew,
#ukrainetransgender issuesstolen electionanthony faucibarack obamaberlin 1920sbiolabsconspiracy theoriescovid 19fifth generation warfarekazarian mafiakhazarian mafianormiesoperation warp speed
00:33:00
28 Feb 2023 Tue
Clif High / Release language dominant.
#woke culturesocial media censorshipseptember 11 attacks15 minute citiesconspiracy theoriescovid 19 pandemiccritical race theoryinvasion of ukrainejfk assassinationkhazarian mafiaoperation warp speedosama bin ladenrelease language
00:34:43
21 Feb 2023 Tue
Clif High / It WAS a secret war....
#zionist alliesworld war iiworld war iappliance durabilitychemical sabotageconspiracy theoriesdeep statedioxinfifth generation warfaregeorge sorosiodinejanuary 6thkhazariansklaus schwabphosgenepolitical awakeningvinyl chloride
00:31:08
21 Feb 2023 Tue
Clif High / Clapping for them...
#vox populivaccine safetypublic clappingchemical weaponsconspiracy theoriesdr robert malonefinderellagender transitiongovernment manipulationkhazarianslegislative assistantsmax egannuclear meltdownosintpsychological warfare
00:34:12
21 Feb 2023 Tue
Clif High / Supremes...
#wafoniansvax damaged peoplevaccine mandatesbidenbrunson casecanadachildhood vaccinescivil warconspiracy theorieskhazariansmax egansocial collapsesupreme courtsweden
00:06:52
20 Feb 2023 Mon
Clif High / Speed of Thought or Teaching a Legislator to think!
#world economic forumvladimir vernadskyrare earth mineralsbuckminster fullerccpdna damageelectric vehicleselectromagnetic fieldsenergy calculusjay insleelithium ion batterieslithium miningmother wefers
00:27:54
15 Feb 2023 Wed
Clif High / Your future = 5GUW
#world economic forumvanguardvaccinentsblackrockchinese communistscivil unrestconspiracy theorieseconomic collapsefederal reserve notefifth generation unrestricted warfarefifth generation warfareglobalist conspiracyillegal aliensohio valleyspace aliens
00:27:08
08 Feb 2023 Wed
Clif High / Banks....you know it is coming.
#world economic forumweimar germanyturkeyconspiracy theorieseconomic collapsefederal reservefood securityglobal banking crisisgreen new dealhyperinflationkhazarian jewsnigeriapandemicpolitical instabilityrockefellersrothschildstalmud
00:31:53
08 Feb 2023 Wed
Clif High / UAP Detection
#unidentified aerial phenomenaukraine waruap detection1177 bcacapulcobronze age collapsekhazarian empiremagnetic propulsionmax eganmicrometeorsnatosocietal collapseuap
00:21:50
06 Feb 2023 Mon
Clif High / Twist yer Noodle
#universe purposetime stabletheological analogyconsciousnesscroatiafuture illusiongodlee merrittnature of timenoveltypsychic abilitiesrandom number generatorsouth africaterence mckenna
00:21:20
01 Feb 2023 Wed
Clif High / Release Language
#wuvax damage reparationsvaccine damagebig uglycensorshipcovid injectablesdata analysislockdownsnaradigmepublic health weaponizationrelease tensionsocial order collapsesocial order controllerstwitterus patent office
00:24:14
01 Feb 2023 Wed
Clif High / Shrapnel incoming...
#world war iiivaxxed driversvaccine narrativesbrazil post election violencec60 purple powerconspiracy theoriescovid vaccinedata analysisemotional tensiongreen cometjanuary 6thkazarian mafiaken schwartzmalorific signrafiukraine war
00:26:38
2023 - January (13)
25 Jan 2023 Wed
Clif High / Triggers...
#world economic forumwoke cultureweaponized empathycritical race theorycrtgender identitygen zgun ownershipjustin trudeauklaus schwabmillennialssecond american revolutionvaccine injury claimsvox populi
00:26:33
25 Jan 2023 Wed
Clif High / Body Cycles
#yellow emperorwestern medical critiquetwitter suspensionalternative medicineartificial intelligencecreatinecrypto transendocrine systemexpert systemglandular replacementintussusceptionmedical compendiumsupplement safetysymptom language
00:30:13
23 Jan 2023 Mon
Clif High / Tiny AI
#yemenworld war iitiny aiartificial intelligenceccpcentralized controlchatgptchinaconspiracy theoriescovid 19global health policyhebrewitesjudeakhazarian mafiathe l
00:14:42
23 Jan 2023 Mon
Clif High / Tiny AI 2
#waste heatunited statesifyingtiny ai systemscentral bankerscentralization failurecolonel schtecklcorey goddecentralized energydisplaced personseuropean unionfriedrichsburgkhazarian mafialithium scarcityreplacement migrationreverse migrationtesla turbine
00:30:23
21 Jan 2023 Sat
Clif High / Hyper Woo Hyper Code
#wraithssoul debrisrace source codeconspiracy theoriesdemonsdna debrisharold percivalhypercodehyperspacehyper woolarge hadron colliderluciferian plotpcr testingpcr tests
00:27:18
21 Jan 2023 Sat
Clif High / Hyper Code Hyper Woo
#world economic forumterence mckennatalmudariansaldous huxleyalternative historybanda achi tsunamicernconsciousness studiesconspiracy theorieshyperspaceklaus schwablarge hadron colliderlizard overlordsmescalinemushroomsnew age beliefspsychedelic experiences
00:25:02
17 Jan 2023 Tue
Clif High / Half Off WEF.....
#world economic forumwef websiteus federal reservebig pharmaclimate change skepticismcryptocurrencydeep statefederal reservegeorge sorosklaus schwabmercury retrogradenaradigmesolar energytwitter suspension
00:25:47
14 Jan 2023 Sat
Clif High / Reality Werkz Perfek
#world economic forumwoke culturesecret societiesage of aquariusbitcoincdcconspiracy theoriesdebt ceilingeconomic collapsefdafreemasonsglobal governanceilluminatikhazarian mafiakol nidrenormiespsychedelics
00:56:02
10 Jan 2023 Tue
Clif High / Deflation kills central banks.
#xrpworld economic forumwef membersbitcoincbdccentral bank digital currencychemtrail formationconspiracy theoriescryptocurrency valuationdick allgaiereconomic recoveryfederal reservefederal reserve collapseklaus schwabsilvertreasury issued currency
00:29:06
10 Jan 2023 Tue
Clif High / The Great Takeover Plot of the 21st Century
#world economic forumsilverpolitical instabilitybiden administrationbitcoinconspiracy theoriescryptocurrencyeconomic collapsefreemasonsglobal governancegoldilluminatijair bolsonarojohn f kennedyluiz inácio lula da silva
00:34:24
05 Jan 2023 Thu
Clif High / Vox Populi
#world economic forumwefweb scraping5gw manualchinese agentsfifth gradient of warfifth gradient wargovernment subversionlegislative assistantslegislative interferencepsychological warfaresubstackuseful idiotsvox populiwaconianswashington state
00:31:45
05 Jan 2023 Thu
Clif High / tempoflavinoids
#the big uglytennessee williamstemporal perceptionadrenalineatmospheric riversbioflavonoidsconsciousnesscortisoldavid bowieenvironmental degradationliving consciousnessmateriumrandomnesstempoflavonoids
00:37:55
02 Jan 2023 Mon
Clif High / System: End
#world economic forumrussian empirenew age movementsage of aquariusciaconspiracy theoriescultural revolutioneuropean unionfinancial collapsefreemasonsgender studieshigh jewish counciljanuary 2nd 2023khazarian empiremother wefernato
00:33:29
2022
2022 - December (12)
29 Dec 2022 Thu
Clif High / Envy much?
#zecharia sitchintartariasumerian cuneiformalien contactancient historycredentialismcultural survivaleducation reformgender studiesgovernment censorshipgovernment intelligence agenciesmother wefersplanet xsouth pacific cargo cults
00:39:10
28 Dec 2022 Wed
Clif High / TEOTCAWKI
#tin traderus peoplerogers1177 bcancient trade networksbronze agebronze age collapsechinacivilizational declineclovis peopleelectric vehiclesfinancial system failurehistorical revisionismkhazariansmycenae
00:34:32
28 Dec 2022 Wed
Clif High / Holey History
#tartariasecret space programssanskrit textsancient civilizationsbronze age collapseciaconspiracy theoriescorey goodeder scheisberg zweitfinancial collapsegovernment censorshipgreat chicago firehistorical revisionismkhazariansmask mandates
00:33:34
21 Dec 2022 Wed
Clif High / 100 Years of Squishiness
#prescienceplucheks wheel of emotionspineal gland100 year squishiness30 year bulgealta reportsasymmetric linguistic trend analysiscensorshipconspiracy theoriesemotion reduction enginefuture predictionk pro 2la unum universitylinguistic analysismother weffers
00:26:10
21 Dec 2022 Wed
Clif High / Once, and future Rinpoche
#vibration theoryvan goghthinking and destinybody dysphoriacellular automatacoronavirusfalkegender identitygrateful deadharold percivalleonardo da vincimetaphysicsmichael jacksonmonetreincarnationspike protein
00:30:06
17 Dec 2022 Sat
Clif High / YOU are delusional
#world economic forumtransgender issuessuperegoaquarianbehavebehavioral manipulationcollective consciousnesscommunismegogreen new dealidideological controlpisceanpresent moment realityrobert sapolskysigmund freudsocialism
00:48:29
14 Dec 2022 Wed
Clif High / Complicated currents
#world economic forumus politicssupreme courtbiden administrationbrunton caseclarence thomasconspiracy theorieselon muskfederal reservegovernment controlhistorical revisionismjohn f kennedykhazarian mafiaroe v wadesoc
00:25:36
14 Dec 2022 Wed
Clif High / P2 and P3
#theoaitalmudsea peoplesancient aliensantarcticaantarctica claimsanunnakibiblical historycargo cultconspiracy theoriesdevasjudeanskhazarian mafialold testamentphoeniciansreligion origins
00:32:41
12 Dec 2022 Mon
Clif High / Oumuamua caused Covid
#zoharworld economic forumwef2030agenda 2050alien lconspiracy theoriescovid 19covid 19 originskhazarian jewskhazarian supremacynumerologyoumuamuaspike proteintalmud
00:32:47
07 Dec 2022 Wed
Clif High / Protocol 1
#world economic forumtitanstheoi6g warfareadrenochromeancient aliensastrotheologyconspiracy theoriesdevahglobal governancehuman contact foundationhuman evolutionjordan maxwellkhazarian mafiaprotocol 1religious textssaturn cults
00:29:09
07 Dec 2022 Wed
Clif High / 5GW
#world economic forumsocial controlpolitical revolution1963american revolution 20conspiracy theoriesfifth gradient of warglobal governancegreen new dealheinrich viiihistorical revisionismkhazarian mafiaklaus schwabmorihei ueshibanovember 22oxfordshire county
00:22:19
03 Dec 2022 Sat
Clif High / Huckleberries of the Living Dead
#wefthe cancer wardsolzhenitsyn5th generation warfare6th generation warfareccphuckleberrieshuckleberry historyjohn boydjohn boyd ooda loopmetempsychosisnative peoplesooda looporac valuespemmican
00:35:51
2022 - November (11)
30 Nov 2022 Wed
Clif High / Mind your state!
#transgender individualssoulsingle state beingalcoholanesthesiaartificial intelligencecannabisconsciousnessgender identityhormonal influencehormoneshuman naturekerry cassidymicrosoftmulti state beingsnon binariesschizophrenia
00:26:28
28 Nov 2022 Mon
Clif High / World War WEF
#world war wefworld economic forumtibetalien abductionsantarcticabaalchinaconspiracy theoriescovid 19 policiesegyptianselohimfoxconnhistorical revisionismjudeanspharaohqr codessalvador
00:47:28
23 Nov 2022 Wed
Clif High / We are winning...
#vatican libraryukraine wartalmudalta reportsantarctica voidarchangel gabrielcatholic churchd classdelawareinformation warfarejfk assassinationkhazarian conspiracykhazariansmarylandreligious history
00:21:11
20 Nov 2022 Sun
Clif High / Wootech
#wutechwireless powertwitter bots5g technologyancient technologiesbuckminster fullerclimate change denialconspiracy theoriesfederal reserveftx collapsegraham hancockjoe rogankhazarian mafianikola teslapolitical upheavalstephen greertartaria
00:59:12
16 Nov 2022 Wed
Clif High / Yank them chains
#vaxvaccine safetyunipartyage of aquariusastrological cyclesdeep statedonald trumpelection fraudinformation warfaremillennialsobama bush administrationprecession cycle
00:22:27
11 Nov 2022 Fri
Clif High / deSTRUCTION of the past
#vanderbiltsvaccine injuriesufo disclosure13th tribe1913astorsc60 purple powerconspiracy theoriesfederal reservekhazariansmillennialsmorgansnormiesnovember 13thpolitical collapsepure sleepsocial unrest
00:39:07
09 Nov 2022 Wed
Clif High / Macron, le Stooge
#world economic forumvoting machine securityus midtermsclimate change denialclimate crisisconspiracy theoriesdominion voting machinesemmanuel macronextinction rebellionhack 5khazarian mafianewsphere seminarpineapple devicespolypad networkre education campstor deep web
00:26:38
04 Nov 2022 Fri
Clif High / ShadowLand - Marching on...
#world economic forumweimar republicsocial memorydiesel supply chainseconomic collapsefrance currency collapsegreat depressionkhazarian mafiamarket opportunitiesnuclear warrafiresource scarcityscenario planningself organizing collectiveshadowland planningsilver coins
00:29:16
04 Nov 2022 Fri
Clif High / Shadowland - Part 1
#supply chain collapsespike proteinsolar minimumbolsonaroc60 purple powercentral bank controlconspiracy theoriesdark webeconomic deflationfalkekazarian mafiaken schwartzsafewayshadowland
00:34:16
03 Nov 2022 Thu
Clif High / The Fed Craps Out #2
#zionistsoviet unionsilver coinsbabylonian money magicblack projectsblockchain payment systemsconspiracy theoriescryptocurrencyeconomic collapsefederal reserveglobal inflationjoe bidenkhazarian mafiapetro dollar
00:36:26
03 Nov 2022 Thu
Clif High / The Fed Craps Out #1
#world economic forumwoodrow wilsonvanderbiltsalbert einsteinbitcoinbolsonarocentral bank collapsefederal reservefederal reserve conspiracygeorge sorosglobalist vs nationalistgold standard returnjay ensleykhazarian mafiakhazarian mafia theoryklaus schwabmorgan familymuammar gaddafinikola tesla
00:24:33
2022 - October (7)
27 Oct 2022 Thu
Clif High / The Turn Worms
#vaccine safetysocial unrestquantum mechanicsalbert einsteinben shapirobig pharmaconspiracy theoriesether theorygreat die offkazarian mafiamillennialsnormie narodymoverwoopandemic narrativepineapple express
00:29:20
20 Oct 2022 Thu
Clif High / Deflation
#xi jinpingweimar republicwefersalbert pikecanola oilconspiracy theorieseconomic collapsefederal reserveglobal eliteshealth hazardshillary clintonjay insleejoe bidenkazarian mafiapolitical corruptionssrisstacey abramsstatinsuk prime minister
00:31:44
20 Oct 2022 Thu
Clif High / History & stuff
#zogzionist occupied governmentyahwehancient historyantarcticaclovis first theoryconspiracy theoriesgizailluminatijain religionkhazarian mafiapole shiftpyramid weatheringreligious originstheosophical society
00:25:41
18 Oct 2022 Tue
Clif High / Yeah, Right.
#xrpvitamin dswift5g towersboston universitycharlie freaksclimate change skepticismconspiracy theoriescorey goodecovid 19 researchfinancial instabilitymad cow diseasepenny kellyremote viewingstephen greersupply chain disruption
00:49:25
11 Oct 2022 Tue
Clif High / Grappling
#vaccine mandatestulsi gabbardpure sleepage transitionaquarian agecatherine austin fitzcollectivism collapsedavid ickedeep statedeep state influencedemocratic partygrappling with karmakarmanskarmic evolutionmax eganpiscean agepolitical realignment
00:43:30
06 Oct 2022 Thu
Clif High / The BIG GAP
#world economic forumvaccine safetyvaccinesacademy of arts and sciencesalien technologybig gapbrain draincentral banking collapsecommunistsfourth generation warfaremillennial generationnew electricssocial engineeringufo technology
00:28:34
04 Oct 2022 Tue
Clif High / Dread
#world economic forumvaccine injuryufo disclosureacademic integrityacademy of arts and sciencesbiden regimecentral bankingchinaclimate change denialcryptocurrency adoptioneconomic deflationfiat currencygold policiesgreat depressionmicrosoftrussiasilver prices
00:33:35
2022 - September (8)
23 Sep 2022 Fri
Clif High / Strats & Tacts for hyperinflation
#world economic forumwifoniansweimar germany401kcurrency collapsedigital currencyeconomic survivalfederal reservefedpaygold standardhard assetshyperinflationindia cashless pushbacknixon shockponzi schemerothschildsstarbucks
00:39:28
23 Sep 2022 Fri
Clif High / Conspiracy & History
#vikingstori saystartariaadrenochromealien contactanunnakicentraconspiracy theoriescorey goodeeconomic collapseelelohimgender identityhistorical revisionismhuman contact foundationkhazarian mafiamother weferssec
00:35:03
22 Sep 2022 Thu
Clif High / cryptos & code
#xrpworld economic forumswiftalternative assetsargentinabitcoincbdcccpcentral bank digital currencycryptocurrency securityfederal reservefederal reserve policygoldgreat resetgreen new dealinflation and debtpay nowsilver
00:27:44
22 Sep 2022 Thu
Clif High / yet more mother WEFfers
#world economic forumwef agendastatins1619 projectcanola oilclimate change denialcovid 19 pandemicdepartment of agricultureglobal conspiracygreat awakeninghealth controlkhazarian mafiaklaus schwabquantum mechanicsseed oilssocial engineering
00:39:34
20 Sep 2022 Tue
Clif High / Ze Big Enchilada
#world economic forumtalmudself sufficiencybig enchiladacentral bankingclimate change lockdownsdepopulation theoryeconomic collapseelectric airplaneselohimglobal conspiracyinflationjay insleejoe roganjordan petersonjustin trudeaukhazarian mafiaklaus schwabmrna vaccinesseed oils
00:40:57
10 Sep 2022 Sat
Clif High / Be Uprising
#world economic forumuniform commercial codestarbucksbethcash economycatherine austin fitzcentral bank controlchinese communist partyclimate changeglobal awakeningglobal walkoutkazarian mafialondon bullion marketprince chuckypure sleep
00:20:33
06 Sep 2022 Tue
Clif High / Quantum computing just ain't...
#theranos scandalsupercoolingstatistical errorsai scamartificial intelligencecarrie cassidycharlie wardexpert systemsobserver effectoxford physicistq anonquantum computingscientific fraud
00:34:44
03 Sep 2022 Sat
Clif High / Narradigm Investigation : LAW
#washington dcunited states incuniform commercial code2008 banking crisisadmiralty lawarticle 1 section 3 clause 17banking cartelconstitutional republicfederal territoriesfemairslaw of war manualrothschildseptember 2nd 2022
00:38:45
2022 - August (10)
25 Aug 2022 Thu
Clif High / U B Classified!
#war collegeufosnsa101st airborne infantryadam and eve storyciacia operationsclassified informationfederal reserve bankfercgovernment secrecyhunter biden laptopkazarian mafialyndon johnsonmilitary intelligencenational security
00:27:15
25 Aug 2022 Thu
Clif High / We are the Champions of the World
#world economic forumtavistock institutestudent debt forgivenessbill gatescovid 19 vaccineseconomic collapsefederal reservefourth generation warfareglobalist conspiracyinformation warfarejeffrey epsteinkhazarian mafiamodernanew world orderred pill
00:31:36
21 Aug 2022 Sun
Clif High / Agents of Universe! Episode 1
#ufo disclosureprecious metalsnikola teslaalternative mediabitchuteconspiracy theoriesetheric fabricfederal reservefiat currencyfinancial collapsefree energyjoseph roger boscovichkazarian mafialarge hadron collidermother wefers
00:24:28
18 Aug 2022 Thu
Clif High / When will it all POP-OFF?
#zionist neo naziworld economic forumwefbill gatescivil warcurrency collapsefederal governmentgeorge soroshyperinflationirs agentsstate nationalstax resistanceun interventionus dollarvaccine injurywashington state
00:29:24
12 Aug 2022 Fri
Clif High / clif high's Narradigm Investigations - ecology
#world economic forumwind turbinesunited nationsclimate changeeconomic declinefederal reserveglobal governancelake meadmalthusmar a lagomother weffersplanned obsolescencerenewable energyrothschildssolar panels
00:29:13
07 Aug 2022 Sun
Clif High / Narradigm: Errata
#woke indoctrinationwashington state electionvote fraudamerican medical associationantarctica coal reservescancer treatmentciaconspiracy theoriesdepartment of educationelection fraudglobal eliteglycogen macrophage activating factorjoe kentkazarian mafiamacrophage activationmedical censorshippolitical corruptionunited nations
00:41:30
04 Aug 2022 Thu
Clif High / Narradigm: religion
#zoharyahwehworld economic forumancient aliensanunnakibiblical historybill gatesconspiracy theorieselohimgeorge sorosglobal elitesklaus schwabmalthusiansnaradigmereligious criticismrothschildstalmud
00:27:38
04 Aug 2022 Thu
Clif High / Narradigm: CBDC
#world economic forumvaccinesunited nationsbitcoinbyzantine empirecentral bank digital currenciesconspiracy theorieseconomic crisisfederal reservegoldkhazarian mafiapetrodollarpetrodollar collapsesatanistssilvertavistock institute
00:29:21
03 Aug 2022 Wed
Clif High / clif's rap
#social credit scoresherr klausgold ownershipanti semitic tropesanti semitismcbdccentral bankingcentral bankstersclifs rapconspiracy theoriesdigital currencyeight gendersgender identity
00:01:24
03 Aug 2022 Wed
Clif High / #CashEveryDay #fuckcentralbank
#world economic forumus federal reservespike proteincatherine austin fitzcentral bankingchina social credit systemconspiracy theoriesdigital currencyfinancial independencekhazarian mafiamao zedongsalaricomsocial credit systems
00:07:32
2022 - July (12)
30 Jul 2022 Sat
Clif High / clif high's Narradigm Investigations
#vladimir vernadskyspike proteinsilver currencyalbert einsteinconspiracy theoriescovid 19 vaccinese=mc²historical revisionismhuman genome projectkazarian mafiamad cow diseasemedical misinformationnaradigm investigationsnarrative paradigmnikola teslascientific fraud
00:35:40
28 Jul 2022 Thu
Clif High / Food Narridigm
#world economic forumvitamin dtransgender identityadrenochromeconspiracy theorieseconomic collapseethylene gasglobalist cabalgreat die offhealth misinformationkeyesklaus schwabmedical establishmentrockefellerstatinstavistock institute
00:30:39
28 Jul 2022 Thu
Clif High / Secrecy Narridigm
#world economic forumrothschildsroswell crashantarcticabill gatescliff highconspiracy theorieseconomic collapsefederal reserve bankfourth generation wargabageorge sorosglobal governancegovernment secrecyklaus schwabpresident bidenpure sleeprockefellers
00:28:35
27 Jul 2022 Wed
Clif High / Secrets Revealed
#ufo disclosuresecrets revealedmaryland1947artificial intelligencecollapse of the dollarconspiracy theoriescryptocurrency collapsedelawaredynamic link librariesfiber opticsfood riotsgovernment secrecyintegrated circuitskazarian mafiakhazarian mafiamachine code
00:32:50
26 Jul 2022 Tue
Clif High / Sri Lanka R Us
#world economic forumwind turbineswefers9 amp solutionclimate changedecentralized energyenergy policyfourth generation warfaregreen ideologyice agekazarian mafiaphotovoltaicsplant based dietsilver based economysri lankatesla turbines
00:17:41
26 Jul 2022 Tue
Clif High / 4th Gen Warfare
#xiwu crowdtrumpclimate change narrativeclimate patterndigital warriorsdynamic resistanceeconomic depressionfourth generation warfaregandhiglobal elite cabaljean baudrillardkazarian mafiamedia collapsenormiespostmodernismpure sleepputin
00:23:45
25 Jul 2022 Mon
Clif High / Alien AI
#yahwehworld economic forumufosbook of abrahamchristian institutionsconspiracy theorieseconomic collapseelohimfederal reserveglobal governancejoseph smithkazarian mafiamormonismproject blue beamreligious disinformationrockefellersrothschildsspace aliensufo phenomena
00:32:23
25 Jul 2022 Mon
Clif High / Sri Lanka R US
#world economic forumus revolutionsri lanka regimeconspiracy theorieseconomic collapsefederal reservefourth generation warfareglobal dominationjay insleekhazarian mafiaklaus schwabmasonic lodgespolitical corruptionsilver prices
00:34:28
22 Jul 2022 Fri
Clif High / frn death
#world economic forumpure sleepklaus schwabantifabill gatesblack lives matterconspiracy theoriesconstitutional crisiseconomic collapsefederal reservefederal reserve notegeorge sorosgreat resethyperinflation
00:19:59
14 Jul 2022 Thu
Clif High / Universe favors humor.
#simon parksqfspolitical associationsanti 5g devicescash launderingcharlie wardconspiracy theoriescustoms declarationdinar exchangeseconomic depressiongeneral flynninternet griftersmed bedsmoney launderingnassara gasara
00:09:39
13 Jul 2022 Wed
Clif High / The BIG Ugly - Part Twoo
#vernadskyvatican facilitiesspace aliensbiopressurebiospherecivilian construction corpsclimate changeconspiracy theorieseconomic recoveryfinancial collapsefood riotsgrand solar minimumkazarian mafiamarch 2023pipeline shutdownspower grid failurespure sleepsolar minimumsound money
00:20:09
12 Jul 2022 Tue
Clif High / Explorers' Guide to SciFi World -> The BIG UGLY
#world economic forumvladimir vernadskysocial orderbiospherebiosphere theoryblmclimate changefederal reservefinancial system collapseglobalist conspiracyholomodorkhazarian mafianewsphereself organizing collective
00:27:51
2022 - June (2)
25 Jun 2022 Sat
Clif High / Explorers' Guide to SciFi World
#world economic forumus governmentufo disclosurebiopressurebiopressure theorycarrie cassidyccpcharlie wardcorey goodedelawareeconomic collapsegreat awakeningkhazarian mafiamaryland
00:16:13
25 Jun 2022 Sat
Clif High / biopressure
#weather delaysvladimir vernadskyvernadsky biospherealgae growthbiopressurebiospherebrush cuttingfirewood storagefloodinggreenhouse managementgreenhouse moldproperty maintenancevegetation overgrowth
00:03:19
2022 - May (1)
06 May 2022 Fri
Clif High / dojo-> medbeds & The Cathari
#vladimir vernadskysimon parksnikola teslaalbert einsteinbiophotonicscatharicathari historycharlie wardconspiracy theoriesdan andrewseconomic collapseelohimgerman inquisitiongonskhazarian mafiamedbeds
01:23:05
2022 - April (3)
28 Apr 2022 Thu
Clif High / dojo->faith
#vagus nervous systemufosthe naked bibleaikidobrahmanistic traditionscentral bankingcentral banking collapsechristianityfirst tongueglobal crisis of faithhistorical revisionismislammauro biglinomicrosoftmonotheistic religionsnature of faithpre platonic greek
00:50:01
20 Apr 2022 Wed
Clif High / dojo->convergency
#zionistsworld economic forumsurveillance stateantichristcbdccentral bank systemconvergencydecentralizationelon muskilluminatiinterstellar aviationjesuitskhazarian mafiamind computer interfaceneuralinkrico lawsuitssecret societiesss7 signaling
00:57:44
01 Apr 2022 Fri
Clif High / dojo-> secrets revealed
#ukraineswiftsecrets revealedalternative financeantifabiden laptop leaksconspiracy theorieseconomic collapseelection theft allegationsfederal reservegovernor insleegreat resetisraelkhazarianspolitical forecastingpure sleepqanon
00:37:02
2022 - March (4)
21 Mar 2022 Mon
Clif High / dojo->Dinner with Trump
#vladimir putinukraine conflicttariffsbitcoinbitcoin adoptioncentral bank collapsedonald trumpeconomic hyperinflationelectric vehiclesfederal reservegold standardincome taxesirsjanuary 6thkazarian mafiarothschild familysound money transition
00:48:14
18 Mar 2022 Fri
Clif High / dojo->[CB]
#western civilization collapseukraine conflictsound money transitionalbert pikebill gatesbitcoincryptocurrency adoptiondominion voting machinesethereumfiat currency critiquefreemasonsgeopolitical conflictglobal central bankinghillary clintonilluminatikhazarian mafiaquantum financial systemrothschilds
00:31:18
18 Mar 2022 Fri
Clif High / oops
#sleep hygienesleep aidpure sleepcliff highcommercial interruptioncurrent eventsenlightened self interestgen 2 sleep aidhealth supplementspersonal wellnesspurebulkcom
00:01:06
05 Mar 2022 Sat
Clif High / dojo->(source code)
#zoharukrainetalmudbiolabsbolshevik revolutionchinese communist partyconspiracy theoriescovid 19geopolitical conflictglobal governanceinformation warfarejoe bidenkhazarian mafiakhazar peopleklaus schwabreligious textsrothschild family
00:44:05
2022 - February (4)
25 Feb 2022 Fri
Clif High / BUDO - Explorers' Guide to SciFi World
#vaxlashunchained innovationukrainebudoclimate changeconspiracy theoriesgeopoliticshood canalice agekhazariapacific northwestprivacy technologypure sleeppurismputinreal estate trends
00:38:15
13 Feb 2022 Sun
Clif High / ka woo - Explorers' Guide to SciFi World
#wucawuvaccine deathsccpdurham investigationelection fraudglobal eliteglobalistsgreat awakeninginformation warkakawukohaimasakatsu agatsunormiesself actualizationsenpaisupply chain issues
00:34:38
06 Feb 2022 Sun
Clif High / escalation woo - Explorers' Guide to SciFi World
#world economic forumvaccine safetyvaccine promotersceaușescu style removalcentral bank structuresconspiracy theoriescovid 19global governancegovernment collapsegreat resetisraeli mistakeklaus schwabmax eganturdo government
00:19:08
02 Feb 2022 Wed
Clif High / doubt woo - Explorers' Guide to SciFi World
#whoopi goldbergtrue socialseed oilsadlbacon fatbeef tallowbitcoincanadian trucker revoltccpcryptocurrency adoptiondoubt wooethereumgeopolitical conflictglobal economic collapsegreat depressionhealth and nutritionjustin trudeaupolitical narrative shiftpure sleep
00:38:56
2022 - January (8)
27 Jan 2022 Thu
Clif High / ROI Woo - Explorers' Guide to SciFi World
#world economic forumwindmillsself educationcryptocurrencyfossil fuelsfusiongeorge sorosgovernment accountabilitygreen energy critiquejay insleejustin trudeauklaus schwabmother teresanuclear powerreturn on investmentroi
00:32:12
18 Jan 2022 Tue
Clif High / E, S & T Woo - Explorers' Guide to SciFi World
#vaccine safetyukrainian aikido practitionerprussian military modelbarter economiescbdcchinademocratic officialseastern europeeconomic collapsegarage industriesglobal chaosglobalistsgreat depressionkazakhstanlocal survival strategies
00:25:05
17 Jan 2022 Mon
Clif High / It's a gas woo - Explorers' Guide to SciFi World
#st germain trustsimon parkssilvercentral bankingcharlie wardcryptocurrency scamsdeep stateeconomic collapsefederal reservegasaragoldhyperinflationiraqi dinarkuwaitmonetary theorynesara
00:43:30
13 Jan 2022 Thu
Clif High / Milioni di Strati Woo - Explorer's Guide to SciFi World
#world health organizationwashington staterand paulalternative medicineanthony fauciccpconspiracy theoriesglobalist controlilluminatikundalini risingmichael levinmind controlorthomolecularorgpolitical transitionpresident biden
00:53:48
08 Jan 2022 Sat
Clif High / Wooology - Explorers' Guide to SciFi World
#zazenwooologyvipassanaalternative physicsconspiracy theoriesfirst principles thinkingglobalist agendasinjecticidesmicro morphogenic fieldsnikola teslaparadigm shiftsrefresh rate of realityretroductionroger boscovichslow twitch personalitiessystemic corruptiontic tacsufo propulsionvax narrative
00:52:56
07 Jan 2022 Fri
Clif High / woo dough
#wudospike proteinsilverbiological warfareccpcovidcryptocurrencycryptoseconomic collapsefederal reservegermanyglobalismglobalistsgoldhyperinflationkazakhstanklaus schwabnorth americaself education
00:44:12
06 Jan 2022 Thu
Clif High / woo dough - Explorers' Guide to SciFi World
#world war iiunited statesspike proteinbiological warfareccpcovid 19cryptocurrencyeconomic collapsefederal reservegermanyglobalist conspiracygold standardhyperinflationkazakhstanklaus schwabself educationsound money
00:44:12
02 Jan 2022 Sun
Clif High / lumpy woo
#urban destructionsmithsonianseattle firebaltimore fireboston firechicago fireconspiracy theoriesdata anomaliesduckduckgoexpert systemsfreemason allegationsfreemasonshistorical revisionismlumpy datalumpy woonew york firessan francisco fire
00:30:36
2021
2021 - December (19)
31 Dec 2021 Fri
Clif High / Lost in the Woo
#underground railroadufossecret societiesanatoly fomenkoantifaanti masonic partyconspiracy theoriescultural puritydeep statefreemasonshan cultural revivalhistorical revisionismnag hammadinew chronologyodd fellows
00:44:03
26 Dec 2021 Sun
Clif High / never bring an ideology to a woo fight - Explorers' Guide to SciFi World
#vaccinesufo activityturkey2041central bankscommunismcryptocurrencycurrency collapsedeep statedonald trumpfreemasonryglobal crisishistorical patternshyperinflationinformation warfaremarxismproceedings of the national academy of sciencestalmudarian authoritarianism
00:51:09
23 Dec 2021 Thu
Clif High / Q uack UP! Woo - Explorers' Guide to SciFi World
#zincsound money theoryself organizing collectivecancer treatmentsccpcrack up boomcryptocurrency regulationdonald trumpdr yamamotoeconomic long wavesfederal reservefenbendazoleglobalist controljoseph stalinmacrophage activation factornagalasenikolai kondratiev
01:00:17
19 Dec 2021 Sun
Clif High / revealing woo - Explorers' Guide to SciFi World
#ufo phenomenatalmud aryanspiritual warfarecaribbeancatharsexploding karmagnosticismhistorical persecutionhypatiaknights templarslinguistic suffixesrevealing woosci fi world
00:40:56
17 Dec 2021 Fri
Clif High / stacking woo - Explorers' Guide to SciFi World
#zincvacuum tube voltmeterskeinar devicesbioelectromagnetismbiofieldcalciumcellular morphogenesiscopper desoldering wickdigital voltmeterdr burrelectrical therapyhydrogeniodinemagnesiummagnetic motormedical diagnosticsmorphogenic fieldsrife machines
00:22:40
17 Dec 2021 Fri
Clif High / swearing woo - Explorers' Guide to SciFi World
#wotantalmudreligious textsalex jonesancient civilizationsbig skull peoplecoloradoconspiracy theoriescorey gooddeath cultglobalist controlglobalistsinternational bankersjurisdictionlegal jurisdictionpatel patriotprussia gate
00:32:25
15 Dec 2021 Wed
Clif High / hidden in the woo - Explorers' Guide to SciFi World
#zionist revolutionvaccinestitanic disasteralternative medicinebritish colonialismconspiracy theorieselongated skullsencyclopædia britannicahistorical revisionisminformation controljames roland engelmorphogenic fieldsnadisecret societiessouthern angola
00:37:15
13 Dec 2021 Mon
Clif High / New Electrics Woo - Explorers' Guide to SciFi World
#youtube algorithmunchained innovationsspintronics5g technologyalgorithmic biasalternative medicinechemtrailsconspiracy theoriesdecentralized energyfdafenbendazolefinancial crisisfuel less magnet motorgraphene osgraphene oxidegulag americaivermectinleast action principlemillimeter wavesnew electrics
00:44:41
11 Dec 2021 Sat
Clif High / Name of the Worm woo - Explorers' Guide to SciFi World
#system of systemspower pyramidpandemic narrativeantifaaustraliacdccnncommunismconcentration campscovid concentration campsdoubtfdajean baudrillardmarxismmedia mind control
00:48:44
11 Dec 2021 Sat
Clif High / Name of the Worm - Explorers' Guide to SciFi World
#system of systemsproximity sensorsproletariataustraliacommunist manifestocovid concentration campsdoubtfaucijean baudrillardkarl marxmedia mind controlpersonnel hrpower linespower pyramid
00:48:44
09 Dec 2021 Thu
Clif High / woo tech - Explorers' Guide to SciFi World
#wutechsilver threadshoshonaartificial intelligenceblack goocounter nadidigital manipulationgreen screen effecthuman consciousnessmeat robotsnadinerve nexusesred green blue filtersretroductive thinkingrittenhouse trial
00:18:55
09 Dec 2021 Thu
Clif High / woo out at the pardigm corral - Explorers' Guide to SciFi World
#vaccine related die offsufosreggie middletonabortionallopathic medicationsbirth controlccpeconomic restructuringglobal paradigm collapsehan chinahan chinese culturehospitalist systemkinetic warfaremao zedongmedical conspiracy theories
00:28:20
07 Dec 2021 Tue
Clif High / It's Wooseful - Explorers' Guide to SciFi World
#woke speakvaccination choicesvaccinationadrenochromeconspiracy theoriescosmic experimentglobalist controlglobalistsherd mentalityhuman traffickingjohn f kennedykarmaneural networkpedophiliapolitical correctnesspost conflict societyself organizing collectivetether
00:39:39
07 Dec 2021 Tue
Clif High / destiny and woo - Explorers' Guide to SciFi World
#vagus nervous systemshiatsushared karmabase karmabug entityenergy bodiesglobalistshyperspacekarmic destinykiyatsumetempsychosispsychic energysddhishared destiny
00:17:56
06 Dec 2021 Mon
Clif High / leaky woo too - Explorers' Guide to SciFi World
#white peoplevagus nervous systemspace aliensakashic recordsantarcticacnncollective karmaconspiracy theoriescosmic warfareglobalist cabalsglobalistshermes trismegistuskarmankarmic mechanicsleaky woomachine elvesmantidspsychic energy
01:18:23
05 Dec 2021 Sun
Clif High / rumors of woo - Explorers' Guide to SciFi World
#vaccine side effectstrumpsmith mundt actbond debacleccpchaga supplementsevergrandeevergrande defaultglobal deflationgold standardgreat resethard currencyobamapetrodollarpetrodollar system
00:38:35
04 Dec 2021 Sat
Clif High / Der Sudpol Wool - Explorers' Guide to SciFi World
#vaccine safetytwitterpcr testingantarctica mysteriesbioweapon allegationsccpchristine lagardeconspiracy theoriescorey goodecryptocurrency manipulationdavid wilcockgaiaglobalist elitesjack dorseyjohn kerryklaus schwabnewt gingrichomicron variant
00:34:04
03 Dec 2021 Fri
Clif High / yule woo - Explorers' Guide to SciFi World
#yule wooyule originswotancodex oralindaglobalist conspiracyground effect liftholy roman empirek club missilesklaus schwabmothers nightname stealingnorwegian fjordsukraine conflictviking boat constructionviking boat hullvladimir putin
00:52:46
01 Dec 2021 Wed
Clif High / spilling woo - Explorers' Guide to SciFi World
#world economic forumvitamin dvaticanalternative medicinecentral bankschagacharlie wardconspiracy theoriesdecember 11thelectric universeelectric universe theoryethermauro biglinomedbedssimon parksspike proteinsufo disclosurevaccine safety claims
00:38:25
2021 - November (17)
30 Nov 2021 Tue
Clif High / trench woo - Explorers' Guide to SciFi World
#ufo technologytic tac ufoq anonccpcmos chipconspiracy theoriesdeep statefalkegeneral flynnghislaine maxwellghislaine maxwell trialglobal warjames comeyjoe bidenlynn wood
00:31:43
28 Nov 2021 Sun
Clif High / roux woo - Explorers' Guide to SciFi World
#wheat glutenvax damagetang zhongconspiracy theoriesdavid ickedeath campsdepopulation agendaelection fraudfood scienceglenn beckglobal elitesmax eganmedia censorshippatriot movementpyrolysisrouxrue woosocial credit systems
00:30:13
28 Nov 2021 Sun
Clif High / frothy woo - Explorers Guide to SciFi World
#ufo phenomenaufo data setssmallpoxalternative medicinebiological warfarechaga mushroomsconspiracy theoriesdata analysisdeep stateebolafuzzy logicgofundmejfk assassinationorac valuesiberian tribes
00:21:00
26 Nov 2021 Fri
Clif High / tides of woo - Explorers' Guide to SciFi World
#woo woo landwizard of ozvitamin daboriginal peoplealternative medicineaustralian defense forcesbiological warfarechaga mushroomconspiracy theoriescorey goodedavid wilcockesoteric knowledgeglobalismindigenous rightsrule of twelfthssmallpoxsolomon islandsvitamin c
00:55:44
22 Nov 2021 Mon
Clif High / crux woo - Explorers' Guide to SciFi World
#washington state ferry systemvaccine safetysocial unrestbiden administrationccpeconomic crisisfederal government contractsgermanygibraltargovernment corruptionhcqisraelkarine jean pierrepolitical instabilityscotland
00:22:17
21 Nov 2021 Sun
Clif High / one point woo - Explorer's Guide to SciFi World
#tan tianrichard feynmanpranaaikidochicosmic radiationdielectric mediumenergy physicsetherether theoryeva wongharahui ming chinglife energy cultivationlinus paulingmartial arts philosophynucleationone point
00:22:48
21 Nov 2021 Sun
Clif High / one point woo: nucleation and bonds - Explorers Guide to SciFi World
#surety insurancesurety bondssourdoughbread motherschemtrailscloud seedinggovernment bondsinsurance exposuremalfeasancenucleationnucleation theorypro se litigationpublic officialsrevised code of washington
00:14:49
20 Nov 2021 Sat
Clif High / Infernal Woo - Explorers' Guide to SciFi World
#special drawing rightssound moneyrittenhouse caseage of aquariusbuild back bettercentral bank controldebt based tyrannyfinancial collapseforced vaccinationgesaragreat resethyperinflationkim gugonnassarapetrodollar empireplan c
00:33:30
20 Nov 2021 Sat
Clif High / Business notes about the Pure Sleep Product
#supply chain issuespure sleeppure bulkblack friday salebusiness operationscost reductiongeneration 2grinding processheat sensitive ingredientshyperinflationingredient reformulationmonk fruitnorth americaorganic sugarsproduct manufacturing
00:18:04
18 Nov 2021 Thu
Clif High / Put the Woo down, and no one gets hurt - Explorers' Guide to SciFi World
#woovaccine safetyvaccine mandates1913boscovichbronze age collapsecivilization declineconspiracy theoriesdepopulation agendaeconomic collapseencapsulated earthfiat currencylocal self sufficiencymateriumscientific paradigmssuper flu
00:45:20
14 Nov 2021 Sun
Clif High / woo flavors - Explorers' Guide to SciFi World
#vagus nerveufo sightingstavistock institute1947biophotonschagaciaconsciousnesscranial nerveselderberry syrupflavonoidshuman sensesnovember 14thpineal glandpolio epidemicseven human senses
01:00:28
13 Nov 2021 Sat
Clif High / yielding woo - Explorers' Guide to SciFi World
#software display issuessnore signaturessmart contract capabilities10 kilometer readingsbitcoin taproot upgradecryptocurrency competitiondeep space weapon impactsdefi patentsgrid patterned seismic activityla palma volcanomulti signature capabilitiesone pass security architecturereggie middletonseismograph data errors
00:15:35
11 Nov 2021 Thu
Clif High / Complications Woo - Explorers Guide to SciFi World
#vaccine mandatestime animalssolar plasma theoryaustraliabioweaponsccpconspiracy theorieseconomic collapsefederal reservegeraldo riveraglobal governancegraphene oxidekyle rittenhouseplasma tubespower elitesatanic ritual abuse
00:37:55
07 Nov 2021 Sun
Clif High / The Shape of Woo to Come - Explorers' Guide to SciFi World
#white mans burdensupply chain collapsesocial justice movementsbioweapon strategyccpchinese communist partycritical race theorycryptocurrency adoptioneconomic depressionimperial cyclesjohn deemind controlpetrodollar systemqueen elizabethsocial emotional learning
00:43:58
06 Nov 2021 Sat
Clif High / The Innocents a'Woo - Explorers' Guide to SciFi World
#world war iiiufosthe innocents abroadbrandon regimecognitive dissonanceconspiracy theoriescriminal actionseconomic inflationhyperinflationmark twainmedia censorshipnormiespresident bidenprice controlsreptilianssocial collapse
00:25:22
06 Nov 2021 Sat
Clif High / woo of attraction - Explorers' Guide to SciFi World
#vaccine safetysociopathssocial engineeringbiden pedophiliabig barn strategychinese selling body partsconspiracy theorieselection cheatingelection fraudhouston rap concertlong conmicroclottingnormiespolitical polarizationpower track tractorpsychopathsself organizing collective
00:26:06
04 Nov 2021 Thu
Clif High / O'woo - Explorers' Guide to SciFi World
#westphalian systemvaccine mandatestreaty of westphaliaaikidoallopathic medicinealternative medicinecancer recoverydave chappellefourth generation warglobalist elitesharajoe rogankimartial arts philosophymorihei ueshibaosenseiowurussell brand
00:59:17
2021 - October (11)
31 Oct 2021 Sun
Clif High / das Woo Brot - Explorers' Guide to SciFi World
#wu brotwhite sandwich loafsatoshi nakamotocolon cancercryptocurrencydas woo brotdietary healthfermentationfermentation bombglobal elitegluten intolerancehuman survivaljulia childlectinsmother starter
00:31:06
30 Oct 2021 Sat
Clif High / Woo UP - Explorers' Guide to SciFi World
#world war ivvietnamvaccine conspiracyconspiracy theoriesdavid ickedeath campsdepopulation agendageorge sorosgovernment controlgulf of tonkinhistorical hoaxesjordan maxwellkoreamandatory injectionspearl harborspanish american waruss maine
00:33:41
26 Oct 2021 Tue
Clif High / X Form Woo - Explorers' Guide to SciFi World
#wokianismvladimir putintransgender issuesacupuncturecaffeineconsciousness manipulationelectromagnetic radiationfastingfermentationgender identityhuman transformationnadi channelsp1 sensorsphantom limb syndromesensory perceptionseven sensessocial emotional learningsocial engineeringsweat lodgest1 sensors
00:59:14
24 Oct 2021 Sun
Clif High / wu wei woo - Explorers' Guide to SciFi World
#wu weithe hundred year marathonsolar minimums36 stratagemsaikidochinese strategydwight d macarthurgeopoliticsgrand solar minimumsike culturekorean warmartial artsmichael pillsburyninjaplasmodic tubesqishi
00:51:20
22 Oct 2021 Fri
Clif High / measuring woo - Explorers' Guide to SciFi World
#vitamin dtrigonometrysteve quaylealternative medicine safetybioweapon claimsccpceltic crossceltic cross engineeringevergrande bondsfinancial market crashesgenomic data risksgold revaluationhuman genome projecthydroxychloroquineivermectinlectinspcr testsseed oils
01:14:42
20 Oct 2021 Wed
Clif High / chrono woo - Explorers' Guide to SciFi World
#world war ivwestern global elitesvaccine safetyccpeconomic collapseevergrande bond defaultsfiat currency systemgeopolitical conflictglobal conspiracygraphene oxidenanoparticlesspike proteinssuper flu
00:57:14
18 Oct 2021 Mon
Clif High / Woo Fighting - Explorers' Guide to SciFi World
#woo fightinguniversity of dubuquerule 11alta reportsamericans with disabilities actcontract lawcorey goodedavid widenerdavid wilcockdeath jabgaia tvjay weidenerlegal strategyoslanderpro se litigationpublic relations lawracketeer influenced and corrupt organizations actrico cases
00:57:35
17 Oct 2021 Sun
Clif High / Auslander Woo - Explorers' Guide to SciFi World
#vitamin dvax portsvaccine passportsauslandersbarbaroibioweapon theoryc60chinese troopsdeath campsdemographic controlglobalist agendahealth conspiracyjoe bidennacspike proteinsuper fluun intervention
00:19:18
15 Oct 2021 Fri
Clif High / straw woo - Explorers' Guide to SciFi World
#vitamin dvaccinespost pandemic chaos2020 electionage of aquariusalternative medicineantarctica coalantibody dependent enhancementccpclimate catastrophismconspiracy theoriescovid 19donald trumpelection integritymail in ballotsmainstream media
00:53:37
08 Oct 2021 Fri
Clif High / FLUX WOO - Explorers' Guide to SciFi World
#vitamin d immunityunrestricted warfarethree pathways17 spike proteinsbill gatesbioweapon allegationschina threat theoryconspiracy theoriesdeep statefalkegrand solar minimummainstream media declinenipah virusoperation mockingbirdself organizing collectivestealth aircraftthree gorges dam
01:11:43
02 Oct 2021 Sat
Clif High / Buttermilk Woo - Explorers Guide to SciFi World
#vitamin d suppressionvitamin dtavistock instituteadrenochromealternative medicineastrological predictionsbavarian beer actbiden administrationchagaconspiracy theoriesfermentation historygerman inquisitionmolochniacin flushingrickets
01:01:01
2021 - September (12)
27 Sep 2021 Mon
Clif High / Wave Woo - Explorers' Guide to SciFi World
#washington dcvolcanic eruptionstsunami waves75 ruleair frictioncanary islandscoastal floodingghost forestla palma volcanomiamimid atlantic ridgenatural disaster mitigationriver basinstsunami physics
00:33:03
23 Sep 2021 Thu
Clif High / Break Down Woo - Explorers' Guide to SciFi World
#vaccine safetyvaccinated driverssupply chain failurecbdcccpchemtrailsconspiracy theoriescovid 19economic collapseevergrandegeorgia guidestonesnanoparticlesnormie breakdownpallet jackingpetrodollar systempopulation controlspike proteins
00:42:00
21 Sep 2021 Tue
Clif High / Potential Probability Woo - Explorers' Guide to SciFi World
#vaccine mandatesufossocial unrestaustralia protestsbig techcharge and dischargeconspiracy theoriesdead man switchdeep stateelectric universeelectric universe theoryjohn mcafeemainstream mediapposingle timeline universe
00:25:43
21 Sep 2021 Tue
Clif High / AstroWoology - Explorers' Guide to SciFi World
#zodiacvegaseptember 21st21602780age of aquariusandromedaastrowoologydecember 28th 2020fixed starsgreat ageheliocentric spiral modeljupiterpleiadesprecession of equinoxessaturn
00:31:03
19 Sep 2021 Sun
Clif High / The Woo Abides - Explorers' Guide to SciFi World
#vaccinesslavssaxon historyadeleage of aquariusage of piscesaryan raceastrological agescatholic churchcodex oralindaconspiracy theoriescritical race theoryhaida lindamagus
00:37:49
17 Sep 2021 Fri
Clif High / EvoWootionary War - Explorers' Guide to SciFi World
#vaccine mandatesthe woobblesocial securityalex jonesbig pharmacaptain john boydccpconspiracy theoriesevolutionary warfarefourth generation warfareinfo warsjohn boydmedical censorshipmoral authorityremdesivir
00:53:26
16 Sep 2021 Thu
Clif High / It's WooTyme - Explorers' Guide to SciFi World
#year old cultrachel maddowoverwuanglo american australian responsesbeyond mystic 3conspiracy theoriesdavid morgandeep statedurhamfalse flag eventsglobal protestsjean claudemedia censorshipnuclear threats against china
00:22:11
14 Sep 2021 Tue
Clif High / What the WOO! - Explorers' Guide to SciFi World
#veganismvagus nerve vulnerabilityvaccines5gagent provocateursconspiracy theorieselectromagnetic radiationglobalist agendasgood fatsmineral levelsoctober 18th protestsschuman resonanceseed oil dietsseed oilssocial unrest
00:54:53
12 Sep 2021 Sun
Clif High / woo and consequences - Explorers' Guide to SciFi World
#vaccine safety claimsspike proteinnacantifaauthoritarian controlbill gateschinacovid 19critical race theorydepopulation agendaeconomic collapsefederal reservefederal reserve failuregraphene oxidegreat bond crashivermectinjoe biden
01:10:02
10 Sep 2021 Fri
Clif High / RED WOO! - Explorers' Guide to SciFi World
#ss7 layersocsimon parks2022charlie wardchina ccp conflictconspiracy theoriesdeep statekim gujonmasogimedia censorshipmichael jaycopacer systempublic purgesq dropsred woosanta surfing
00:55:29
04 Sep 2021 Sat
Clif High / ukemi woo - Explorers' Guide to SciFi World
#wolf blitzervinny eastwoodukemibill gatesccpclintonsdeep state exposéfinancial collapsegeraldo riverahyperinflationjoe bidenklaus schwabmartial arts philosophymedia censorshipremote viewingsocspiritual warfarestate of china
01:04:29
03 Sep 2021 Fri
Clif High / aSymmetry wOO - Explorers' Guide to SciFi World
#vaccine mandatestelepathic raystactical nuclear explosionsasymmetrybiden administrationchiconsciousnessdeflationary eventdepopulation agendaelite controlglobal collapsemagnetismpetrodollar collapsepetrodollar systempranasanskritspace bug
00:50:54
2021 - August (16)
29 Aug 2021 Sun
Clif High / Waiter, there is a bug in my woo - Explorers' Guide to SciFi World
#vaccine safetythe bugpreparednessanzacscatholic churchccpconspiracy theorieseconomic collapsefabian societyfreemasonsglobal governanceisrael vaccinationkarl marxknights of maltalithium shortagemr globalnazi germany
01:06:58
24 Aug 2021 Tue
Clif High / Weird WARNING Woo - Explorers' Guide to SciFi World
#vaccine hesitancyvaccinationpsychic targeting5g radiationanti vaxxerscolon cancerconscious controldirected energy weaponsmeditationneedle phobianorthern hemispherepsychics
00:14:53
24 Aug 2021 Tue
Clif High / Here, hold my woo - Explorers' Guide to SciFi World
#vitamin dvaccine safetytrumpbidenbill gatescytokine stormsdeep statedeep state theoryfdafda corruptiongovernment mandatesharrismodernamrna vaccinespfizerpopulation controlspike proteins
00:50:51
24 Aug 2021 Tue
Clif High / Here, hold my woo 2 - Explorers' Guide to SciFi World
#vaccine mandatesvaccination claimsnuclear waralbert pikebiden harrisblack deathconspiracy theoriesdeep statedepopulation agendadevolution peopleeconomic collapsefdamedia censorshipmilitary power grabs
00:10:02
22 Aug 2021 Sun
Clif High / Chronic Haze Woo - Explorers' Guide to SciFi World
#wuvitamin dvaccine safetyalbert pikebioweaponconspiracy theoriescovid 19economic systemsglobalist plotglobalistsgoldhard moneynormiespetrodollarpetrodollar collapsesilvertrump administration
00:51:17
16 Aug 2021 Mon
Clif High / Next Level Woo
#vaccine side effectsvaccinated individualssilveranthony faucibill gatesbitcoincryptocurrencyeconomic depressionfederal reservefinancial collapseglobalist conspiracygoldjanuary 2022joe bidenkerry cassidymax egannovember 11thpandemic euthanasia
01:06:38
16 Aug 2021 Mon
Clif High / Next Level Woo - Explorers' Guide to SciFi World
#vaccine safetyprecious metalspost soviet russiabill gatescryptocryptocurrencydigital currencyeconomic collapsefaucifederal reserveglobalist conspiracygreat die offjoe bidenkamala harrisnovember 11thpetrodollarpopulation decline
01:06:38
15 Aug 2021 Sun
Clif High / WOOplosion
#woo plosionvaccine safetyoverwooage of aquariusanti body dependent enhancementanti vaccine sentimentbiden administrationborder securitydeath shotelection fraudelection theftmainstream mediamedia censorship
00:52:31
14 Aug 2021 Sat
Clif High / jelling the woo
#wuwestern civilizational declinevaccine safetyage of aquariusage of piscesbill gatesbreakthrough caseschinese communist partyconspiracy theoriescovid 19 pandemicelohimglobal paradigm shifthan chinesejoe bidenreptilian ancestryvaccines
00:42:16
14 Aug 2021 Sat
Clif High / woo d'etat
#wu détatsound moneyshaka zuluasian communitybiden regimebioweapon attacksccpcdc documentschina us conflictconcentration campsconstitutional crisiscorn potatoes peascoup détatgold based sound moneyhitlers germanymacronoctober 16 2022overwooracial weaponization
00:48:20
14 Aug 2021 Sat
Clif High / woo d'etat - Explorers' Guide to SciFi World
#wu détatwoovoting machinesasian discriminationbioweaponsccpchinese communist partycivil unrestconspiracy theoriescoup détatdivide and conquereconomic collapsejoe bidennational preparedness monthoverwupolitical conspiracysound money
00:48:20
13 Aug 2021 Fri
Clif High / jelling the woo - Explorers' Guide to SciFi World
#vaccine safetyracial supremacypersiansage of aquariusalexander the greatbill gatesccpconspiracy theoriescovid 19global governancehan chinesejoe bidenmental healthming the mercilessopium wars
00:42:16
08 Aug 2021 Sun
Clif High / Detonation of the Woo - Interview with Jay Campbell - 8/8/2021
#wrongful terminationvitamin dvaccine skepticismage of aquariusconspiracy theoriesdeep stateeconomic collapsegavin newsomhostile workplace complaintsivermectinlarry elderlegal resistancemrna vaccinesprotolytic enzymesspike proteinsspiritual awakeningsupply chain disruption
01:15:51
05 Aug 2021 Thu
Clif High / WOOplosion
#woo plosionvaccine safetyoverwooage of aquariusanti body dependent enhancementanti vaccine sentimentbiden administrationborder securitydeath shotelection fraudelection theftmainstream mediamedia censorship
00:52:31
05 Aug 2021 Thu
Clif High / WOOplosion
#woo plosionvaccine statisticsvaccine mandatesaquariusbiden administrationconspiracy theoriescouncil on foreign relationsdeath shotelection fraudfifth columnistsforced inoculationsmedia controloverwoopandemic narrativespcr testtavistock instituteunited nations
00:52:31
01 Aug 2021 Sun
Clif High / mayonnaise woo - Explorers' Guide to SciFi World
#vitamin dtear gaspower elitesaikidocivil unrestconspiracy theoriescovid 19deep stateflying teamsglobalistsglobal revolutiongojuivermectinkettlingmayonnaise wunonviolent resistancepolice tactics
00:38:55
2021 - July (10)
31 Jul 2021 Sat
Clif High / wootage - Explorers' Guide to SciFi World
#woutagewooden shoesvitamin cfourth industrial revolutionglobalist conspiracyglobalistshuman population reductionindustrial revolutionklaus schwabsabotagesalinesupply chain sabotagesupply chain workersvaccine distributionvaccine mandates
00:15:26
30 Jul 2021 Fri
Clif High / tidal woo - Explorers' Guide to SciFi World
#vaccine mandatestidal woo effectsocial unrestbig pharmacdcdeath bloomdeep statefauciglobalistsgreen passluciferian calendarmedia censorshipmicroclottingpandemic fraudq terroristsrefuseniks
00:29:17
27 Jul 2021 Tue
Clif High / Just another Woo cult - Explorers' Guide to SciFi World
#za zenwu cultvipassanabig bang theorybruce leechan buddhismconsciousness realityetheric paradigmfrequency vibrationlittle bloop theorymed bedsmeditation techniquesnikola teslapeak experiencesimon parksskinar devicesstop motion system
00:42:41
25 Jul 2021 Sun
Clif High / freqy woo - Explorers' Guide to SciFi World
#warren buffettunited states magistrate judgethomas paineaquariusbenedict arnoldbill gatesccpconspiracy theoriescorey goodcounterinsurgencycovid 19global freedom dayglobal humanity constitutionglobalismlegal defensepolitical revolutionrico caserockefellersslapps
01:00:43
24 Jul 2021 Sat
Clif High / the art of woo - Explorers' Guide to SciFi World
#safety pinsprotest tacticspolice controlanti faaustraliablmcivil unrestcounterinsurgencycrowd coordinationfreedom dayglobalistslooming behaviorplastic zip ties
00:22:22
18 Jul 2021 Sun
Clif High / tippy woo - Explorers' Guide to SciFi World
#vitamin dvaccine safety concernstavistock instituteage of aquariusage of piscesblood clotschemtrailsconstitutional united statescovid 19donald trumpelection fraud claimsgerman green partyglobalist conspiracyjoe bidenoperation mockingbirdpetrodollar
00:52:57
12 Jul 2021 Mon
Clif High / emerging woo - Explorers' Guide to SciFi World
#vaccine safetyspike proteinnanoparticlesage of aquariusalta reportsbig pharma declineconspiracy theoriescuba hyperinflationdonald trumpeconomic collapsefalke emailsgraphene oxidejehovahs witnessesjimi hendrixluciferasemainstream media censorshipmedia censorship
00:23:50
11 Jul 2021 Sun
Clif High / Empire Woo - Explorers' Guide to SciFi World
#xi jinpingvaccine safetytaiwanchinese communist partycovid 19empire collapsefederal reserveglobalist controlgreat resethyperinflationivermectinklaus schwablitecoinpeoples liberation armypetrodollarproducer price indexsound money
01:13:43
05 Jul 2021 Mon
Clif High / dead Q Woo - Explorers' Guide to SciFi World
#webbotus empire collapseus dollar collapseamerican revolution tooamrev2bitcoinbitcoin predictioncorey goodecultist threatscultural revolutionjordan sathermainstream mediapredictive linguistpsychological operationsq anonq anon originsself organizing collective
00:46:01
02 Jul 2021 Fri
Clif High / Wampum Woo - Explorers' Guide to SciFi World
#wampumtreaty of tordesillassmallpoxbiological warfareccpcolonial historycovid 19crypto assetseconomic collapsefiat currencyglobal revolutiongreen new dealindigenous gravesindigenous rightsklaus schwab
01:07:08
2021 - June (6)
30 Jun 2021 Wed
Clif High / Mantids & Mastery Woo - Explorers' Guide to SciFi World
#vagus nervous systemsilvermantidsccpcentral bankschinese communist partycryptocurrencydeep statefalse flagsfomoglobalismgoldhyperinflationinterdimensional travelerirregular warfarejuly
01:08:54
24 Jun 2021 Thu
Clif High / Electric Woo of Change - Explorers' Guide to SciFi World
#wireless powervaccine safetyteslaalternative physicsanti gravityboscovichccpconspiracy theorieseconomic collapseflorida condominium collapsekarl marxmantidsnacpetrodollarsolid state receiversspike proteinsswift system
01:06:51
19 Jun 2021 Sat
Clif High / Pardon my Woo - Explorers' Guide to SciFi World
#xi jinpingvaccine safetyvaccine adverse effectsbill gatesbioterrorism conspiracycharlie wardcovid 19depopulation agendaglobal power elitesinfertilityklaus schwabmedia censorshipmrna vaccineorgan damagesimon parkssocial collapsespike protein
00:52:59
14 Jun 2021 Mon
Clif High / Temporal Marker of Crowds Attacking Media
#speaker outburstlockdownslockdown legalitycivil libertiesgovernment authoritygovernment overreachindoor confinementlegal status
00:00:31
14 Jun 2021 Mon
Clif High / "Hello" Woo - Explorers' Guide to SciFi World
#washington stateturtle shellstarotalien contactcharlie wardchemtrailsconspiracy theorieselohaelohimhuman evolutionjoe bidenmandatory vaccinationsmind controlnorthern californiaoregonpopulation controlsasha stone
00:53:01
06 Jun 2021 Sun
Clif High / Wild Strain Woo - Explorers' Guide To SciFi World
#xi jinpingvitamin dvaccine safetyalien contactantarcticaantarctica secretsanunnakibiophotonsccpconspiracy theoriescovid 19covid 19 originselohimgolden meanlittle bloop theorynear death experiencespike proteinspiritual awakening
01:04:42
2021 - May (12)
30 May 2021 Sun
Clif High / Vindication Woo! - Explorers' Guide to SciFi World
#wuhanspike proteinskull and bonesage of aquariusbiowarfare claimsblack lives matterccpchaga mushroom teachapel hillconspiracy theoriescovid 19cryptocurrencyeconomic collapsefederal reserveglobal governancepetro dollarsecret societies
00:41:26
23 May 2021 Sun
Clif High / OverWoo - News & Woomers : Explorers' Guide to SciFi World
#vaccine safetythree gorges damsystem collapseaerosolized spike proteinantarcticablack lives matterclimate changeconspiracy theoriesdmxeconomic collapsehank aaronice age victimsoverwoo newsregional bank failuressocial engineering
00:46:17
22 May 2021 Sat
Clif High / American Woolette - Explorers' Guide to SciFi World
#xenophobiavitamin d deficiencyufo disclosure2020 election fraudamerican rouletteconspiracy theorieseconomic survivalglobalist controlglobalist eliteshealth misinformationkarl marxmrna vaccineprionsself organizing collectivespike proteinssystemic collapsethird wave pandemic
00:55:18
20 May 2021 Thu
Clif High / FUD WOO! - Explorers' Guide to SciFi World
#wuhanvitamin d depletionviking revolution1929 stock market crashbitcoinbitcoin market manipulationchinese ccpcoronavirus conspiracy theorieselon muskfear uncertainty doubtgrand solar minimumgreat depressiongreat depression parallelsgrid failuresrobert david steelescandemicspike proteins
00:52:31
16 May 2021 Sun
Clif High / The Woo Deal - Explorers' Guide to SciFi World
#wu dealwou dealwooflationcryptocurrencydouglas firsether physicsfrequency miningglobal debt bubblehyperinflationmagnetic drivesmagnetic propulsionnikola teslareggie middletontesla challengetimberlandufo disclosurevari smart contract coinswaste propulsion
01:07:56
15 May 2021 Sat
Clif High / Leaky Woo - Explorers' Guide to SciFi World
#wuhanvaccine skepticismscott mckayanthony fauciccpcharlie wardcovid 19 originglobalist conspiracyjordan satherlab leak theorymel kayemichael jayomodernanino rodriguezpfizerpolitical collapsequantum financial system
00:49:42
11 May 2021 Tue
Clif High / Borg Woo - Explorers' Guide To SciFi World
#vaccine incompetencespace energiesschuman frequenciesborg wooconspiracy theorieshuman nanobotsmagnetic fieldsmagnetic phenomenamoon positionnanobotspipeline shutdownrefrigerator magnets
00:14:28
10 May 2021 Mon
Clif High / Mimimum Woo! - Explorers' Guide To SciFi World
#vaccine safetyvaccine health issuessuvscarbon dioxidechaga teaclimate skepticismeconomic deflationglobal coolinggreen techgulf streammaunder minimumpine needle teasolar activity cyclessomalisspike proteins
00:41:39
09 May 2021 Sun
Clif High / Woo News ! - Explorers' Guide To SciFi World
#xe2headervoting machinesspike protein sheddingarizona auditconspiracy theoriesdeep statedominion voting machinesmainstream mediamrna vaccinesperseverance roverschumann resonancessolar activity
00:39:55
08 May 2021 Sat
Clif High / Brake 4 Woo - Explorers' Guide to SciFi World s0e7
#washington state i 5venezuelavaccine safetyalien abductionsbob lazarc60ccp rocketclimate changeconspiracy theoriesdeep stateeconomic collapsefiat currencygray alienshyperinflationkubanonormilandpuberty blockers
00:28:25
02 May 2021 Sun
Clif High / You Woo? - Explorers' Guide To SciFi World
#vaccine skepticismuyghur genocidesun diseaseagenda 2030antifaastrophysicscensorshipconspiracy theoriesdo it yourself bioengineeringencapsulation earthglobal resetgreat awakeninggreat resetmay 2ndmind control
00:32:01
01 May 2021 Sat
Clif High / pivot - Explorers' Guide to SciFi World
#world war iiivaxvaccine safety concernsccpconspiracy theoriescovid 19free energy devicesglobal social collapseindiamay day riotsmedia censorshipmedical authoritarianismmrna vaccinesparisprionsspike proteinufos
00:54:53
2021 - April (21)
27 Apr 2021 Tue
Clif High / Vaxxxidents - Explorers' Guide to SciFi World - 2021.4.27
#woovaxxxidentsvaccination side effectsalternative informationalzheimerscognitive dissonancecognitive dysfunctiondementiaelite retrenchmentessential workersmainstream mediamainstream media collapseoverwooingsocial breakdown
00:10:09
26 Apr 2021 Mon
Clif High / The OverWoo
#vax issuesufo disclosuressumerian historybitcoinbitcoin price surgebyzantine empirecold weather realitiesconservative survivalismdollar empire collapseeconomic collapseglobal warming narrativeglobal warming skepticismhistorical paradigm shiftsmaoist cultural revolutionmedia credibility crisisofficialdom paradigmoverwoosilver vs gold
00:40:32
25 Apr 2021 Sun
Clif High / Woozes - Explorers' Guide to SciFi World
#world economic forumvaccine safetyufosage of aquariusbioweaponschinaconspiracy theoriescontagious vaccinosiscovid 19deep stateeconomic collapsegreat awakeninggreat resetmartin armstrongsilent secret warspike proteins
00:52:11
24 Apr 2021 Sat
Clif High / Next Level Woo - 2021.4.23
#woke ideologyvaccine side effectsvaccine safetybitcoinccpconspiracy theoriescontagious vaccinosiscryptocurrency marketscultural marxismdeep stateeconomic collapsefederal reservefort detrickilluminatimodern monetary theorymrna vaccinesrife machinesstudent loans
01:00:28
22 Apr 2021 Thu
Clif High / Explorers' Guide to SciFi World - Wooble of Vision
#woke ideologyvaccine safetyspike proteinscommunist partydepopulation agendaglobalist conspiracyglobalistsgreat awakeninglunar cyclesmateriummenstrual irregularitiesmrna vaccinespopulation controlsocial collapse
00:43:56
21 Apr 2021 Wed
Clif High / Shedding Woo Too ! Contagious Vaccinosis !
00:00:00
21 Apr 2021 Wed
Clif High / Pure Sleep Commercial
#sleep aidsserotoninpure sleepcancer recoverycolon cancerdairy alternativesgut healthhemp milkintestinal walljet lagmelatoninnerve liningsnutritional supplementsoat milkpregnancy caution
00:05:03
21 Apr 2021 Wed
Clif High / Shedding Woo Too ! Contagious Vaccinosis !
#vaccine safetyspongiform encephalitissponge braincontagious vaccinosiscytokine stormsdepopulation agendaimmune system collapseinfertilityisrael datamandatory vaccinationmenstrual issuesmrna vaccinespassive inhalationpheromonal transmissionspike protein
00:58:20
21 Apr 2021 Wed
Clif High / The Wooble. 2021-4-11
#wobblestop motion animationrodent coilsboazdielectric planeenergy generationetheric fieldsfreemasonsfundamental physicsjoachimken wheelerlittle bloop theorymagnetism theoryquantum oscillationrobert boscovich
00:28:14
19 Apr 2021 Mon
Clif High / Shedding Woo!
#vaccine safetysocietal collapseprion like brain damageantifablmconspiracy theoriesdepopulation agendadirect current electricitydncfaucigender identityglobalistsinfertilitymiscarriagesmrna vaccinesobamaoff grid projects
00:37:19
19 Apr 2021 Mon
Clif High / Shedding woo 2021.4.19
#youtubevideo hostingvideo descriptionbitchutedecentralizationdecentralized platformindexing speedsurl
00:00:35
18 Apr 2021 Sun
Clif High / Pure Sleep Commercial
#vegetarian supplementsleep aidsserotonin regulationcancer recoverycolon cancerdigestive healthhemp milkjet lagmuscle mass lossnutritional supplementsoat milkpost exercise fatiguepregnancy cautionpure sleepserotonin
00:05:03
18 Apr 2021 Sun
Clif High / Mama Youtube is a bitch.
#youtube policiesyoutubewu seriesbitchutecliff highcontent censorshipcontent filterscreator economycreator incomepatreonplatform migrationplatform redundancy
00:01:48
17 Apr 2021 Sat
Clif High / Woo Never Sleeps
#woo never sleepsvitamin dvaccine safetyanthony faucibanda achi earthquakeconspiracy theoriescovid 19 pandemicdata maskingglobal eventsice agemedical misinformationmrna vaccinesscott peterson trialspongiform brain diseasessterility
00:24:00
17 Apr 2021 Sat
Clif High / Woo Flows
#zimbabwean zimvietnamese dongufosalien abductionscharlie wardciaconspiracy theoriescryptocurrency scamsfederal reservegold standardgrand canyoniraqi dinarpure sleepquantum financial systemsimon parkssun disease
00:31:41
11 Apr 2021 Sun
Clif High / the wooble - 2021.4.11 comments off due to clucking spammer
#wobbletheory of natural philosophytepleyanker wattboazconspiracy theoriesetheric field theoryfreemasonsgobecklejoachimken wheelerlittle bloop theorymagnetism mechanicsnikola teslareality oscillationrodent coilsroger boscovichsecret societiessolid state technology
00:28:14
11 Apr 2021 Sun
Clif High / woo knew - 2021-4-11
#woolseywoobleufosacademic controversybiden administrationboscovichciaconspiracy theoriesdeep stateeric weinsteinextraterrestrial contactgovernment secrecyjoe roganpentagonphysics theoriesradical etheristssmith mundt act
00:24:33
11 Apr 2021 Sun
Clif High / woobletease
#understandingreality conceptsrealitydestinydestiny masteryencounterforceindividualsmasterypersonal power
00:00:43
09 Apr 2021 Fri
Clif High / Perpetwooity 2021.04.09
#ufosufo disclosurepatreonalien contactancient eveningscatharsconsciousness transferelite controlilluminatikarmaknights templarmetempsychosisnorman mailerold souls
00:53:46
04 Apr 2021 Sun
Clif High / teaser ***BE ADVISED - The Whatsapp spammer is back.
00:00:00
04 Apr 2021 Sun
Clif High / Woo Man Chew - 2021.4.4 ***BE ADVISED - The Whatsapp spammer is back. Do not respond to comments.
#wu mindwu man chewufo disclosureacademic rigidityalternative energybrett weinsteincatalina islandconspiracy theoriesdarwinismfreemasonsfuelless magnetic motorsheather heyinghuman evolutionjared morannikola teslaoverwooing
01:15:01
2021 - March (11)
28 Mar 2021 Sun
Clif High / The End of Woo! - watch out in comments ffor the crypto spammer - not me.
#uss nimitzufosufo disclosure2019 incidentscongresscosmologydeep statedefense intelligence agenciesevolutionary biologygeneral relativitygovernment reportmainstream medianon human contactquantum mechanicsscientific paradigm shiftsocial order collapsetic tac drone
00:26:33
27 Mar 2021 Sat
Clif High / Point of Woo
#youtube censorshipworld war ii ammunitionufos50 caliber roundbitcoinblack holeschinade dollarizationglobal supply chainsinchoate materiumpatreonradical etherismrussiasand dollarslappsubscribestarsuez canal
00:58:59
21 Mar 2021 Sun
Clif High / The Pulse of Woo!
#ufostime travelthe pulsebig bang theoryboscovichchemical complexityconsciousnesscosmologyentropygeometric principlesinformational complexityjainismkarmamagnetismsimulation theory
00:47:04
20 Mar 2021 Sat
Clif High / Time Enough for Woo!
#wokeismufo disclosuretime perceptionbiden pretendencycommunismcosmic rayseconomic collapsegigapanhyperinflationimmediacy systemkarmic challengeslittle bloop theoryperseverance roversilver and goldsound money
00:52:08
16 Mar 2021 Tue
Clif High / Woofoobix
#woofubixwokian religionwhite supremacistsage of aquariusage of piscesasymptomatic spreaddollar empiredollar empire collapseenlightened self interestmainstream mediamodern monetary theoryobservational dilemmasigma maleuniversal basic incomevaccine mandates
00:39:50
13 Mar 2021 Sat
Clif High / The OverWoo
#vax controversysumerian overwoosilver price surgebad moneybiden election resultsbitcoinbitcoin forecastbyzantine overwooconservative mindsetcurrency devaluationeconomic collapseglobal instabilityglobal warmingice agemaoist overwooofficialdom paradigmoverwoosilver prices
00:40:32
10 Mar 2021 Wed
Clif High / Woo Mag Crew - 2021-3-10
#woo mag crewsilvermaunder minimumalternative energybankstersbitcoincivilization 10civilization 20climate changeconspiracy theorieseconomic collapseetherether theoryexpando earthgoldhasselback arraysjean claudelorentz effectmagnetic drives
01:05:49
07 Mar 2021 Sun
Clif High / Woo Rules!
#wootranshumanismpolitical instabilitybiden administrationbyzantine empireccpcharlie wardclimate changecurrency debasementenergy independenceglobal economic collapsegreat resetice ageintersectionalityiraqi dinarjimmy savillekondratiev cyclemagnetic motorsnikola tesla
00:50:30
05 Mar 2021 Fri
Clif High / Woo's Money Is It?
#year woowuwokian cultural marxistsbitcoin adoptioncomexcrack up boomcurrency debasementeconomic collapsejune 2025march 2025mass immigrationnormie paradigmreindustrializationsilver standardstudent debtsupply chain breakdown
00:53:37
02 Mar 2021 Tue
Clif High / woo treatment 2021-3-2
#zincvitamin dtocotrienolsalternative medicineamazoncancer treatmentchaga mushroomfenbendazoleketo dietliposomal vitamin cmetabolic conditionsnative americansnutritional supplementspolio vaccineselenium
00:14:30
02 Mar 2021 Tue
Clif High / Woo ships -2021-3-2
#wu shipsunidentified aerial phenomenatic tac ufosalternative energy sourcesboscovichelon muskenerata unitsetherexotic propulsion systemshover carslimit point drivesmagnetic breaking experimentsmagnetic levitationmagnetospheremetal xoff grid livingtheoretical physics
00:38:33
2021 - February (9)
27 Feb 2021 Sat
Clif High / For Men Only - Talk about T production
#tongkat alitestosterone optimizationtestosteroneahimsaashwagandhabreast cancercancer recoverycarnivore dietcolon cancercordyceps mushroomscortisoldietary restrictionshormonal balancelibodonprimal dietred light therapyskin cancersupplement safetytestalutin
00:34:33
23 Feb 2021 Tue
Clif High / Wooflation 2021-2-23
#wooflationsilver squeezesilver market dynamicsbitcoincommunist party of chinacryptocurrency adoptiondollar collapsedollar empireeconomic meritocracyfederal reservefederal reserve critiquehelicopter moneyjanet yellenkenyanigeriaopium wars
00:46:55
20 Feb 2021 Sat
Clif High / c60commercial
#vitamin clongevityken swartzantioxidantsavocado oilc60 purple powercellular healthcosmic raysenergy restorationeye healthhealth supplementsjoint mobility
00:02:40
20 Feb 2021 Sat
Clif High / Space Woo -2021-2-20
#waning magnetosphereufo disclosurespace wooarea 51bitcoinclimate adaptationeconomic depressionelon muskfreedom of information acthyperinflationice ageinternational space stationjohn kerrymagnetic motorssilver squeezesolar minimum
00:42:45
16 Feb 2021 Tue
Clif High / Sun Woo - 2021-2-16
#wuhan outbreakvitamin supplementationvitamin dclimate changeconspiracy theoriescosmic radiationcytokine stormseconomic collapseengineered specimensfreedom of information actgreening energy initiativesice ageinfertilitypandemic originspathogenic primingsolar cyclesufo debris
00:59:29
14 Feb 2021 Sun
Clif High / Woonomics - 2021-2-14
#woonomicswall streetspace economicsbitcoincentral bank failureconstitutional republiccryptocurrencyeconomic collapseethergoldkondratiev winteroption expirationsprecious metalssilver
00:53:05
12 Feb 2021 Fri
Clif High / Year Woo - 2021/2/12 Conwoosions
#white house tunnelsvice president harrisufo disclosurescharlie wardconspiracy theoriesextraterrestrial lifefinancial collapsefirst principles thinkinggovernment deceptioniraqi dinarmedia manipulationnassara ghassarapresident bidenrobert david steelesilver marketsimon parkstenax propositi
00:48:08
07 Feb 2021 Sun
Clif High / Fog of Woo
#xi jinpingvladimir putinsimon parkscaliforniacriminalrecordsorgcharlie wardconspiracy theoriesdavid wilcockdonald trumpether modelgeopoliticsmisinformationnarendra modinikola teslapenny kellypsyopsrobert david steelerule of lawsasha stonescience skepticism
00:44:58
04 Feb 2021 Thu
Clif High / Year Woo ICE WOO
#remote viewingnetwork cardmars anomalies38j9n31antarcticaantarctic structurecensorshipconspiracy theoriesdick algierdonald trumpgalactic information piratesice woointergalactic internetjoe rogan
00:18:17
2021 - January (6)
26 Jan 2021 Tue
Clif High / Year Woo - Woo War
#woo warvaccine safetyvaccine adverse reactionsage of aquariusantarcticaastrologybiden administrationccpconspiracy theoriescovid 19donald trumpgeopoliticsgrand conjunctionmedia censorshipufo
00:35:16
24 Jan 2021 Sun
Clif High / Year Woo
#year wooxi jinpingweaponized empathyantarcticaantifabiden administrationblmccpchinese communist partycovid 19 originscritical race theorycurrency instabilitygeorge sorosgreat awakeninggreat resetsars cov 2social engineeringufo disclosure
00:36:07
20 Jan 2021 Wed
Clif High / Modern Byzantine Empire Update
#vagus nervous systemsimon parkspolitical forecastingalternative medicinecensorshipconspiracy theoriesdavid wilcockgroundinghenrijanuary 20 2021les cliquemagnetic braceletsmob mentalitymodern byzantine empire
00:14:20
16 Jan 2021 Sat
Clif High / 2021 01 16 SciFi World! We're HERE!
#weimar republic hyperinflationthalidomidespintronics research1918 flu pandemicage of aquariusastrological cyclescyclic history theoryether theoryfrederick bodemerhomeschooling educationjoseph roger ruggero boscovichlancelot hogbenloom of languagemasonic partymath for the millionsmrna vaccinemrna vaccine safetysaturn returnspintronics
00:49:23
13 Jan 2021 Wed
Clif High / besmart2021
#zen meditationwest coast timeuyghursccpchina policycommunist chinese partyconspiracy theoriescultural marxismdc conflictsglobal crisisjanuary 20thmartial artsmilitary analyticsnazi style campsrace warsunrestricted warfare
00:18:00
13 Jan 2021 Wed
Clif High / stupid fux
#virologysimon parksquantum computingartificial intelligencecharlie wardcolumbia universityconspiracy theoriescovid 19great resetkarmic blowbackmedia criticismmisinformationmolecular biologynasarapenny kellypublic healthquantum computers
00:07:56
2020
2020 - October (1)
27 Oct 2020 Tue
Clif High / high effect- magnets
#trademark disputestetrahedronspure sleep profitsblended dielectric planeblue space chicken cultdielectric inertial planesdielectric planesfolded dielectric planefree electricityfree energy deviceshigh effecthourglass magnetsmagnetic resistance shoesmagnetic shieldingneodymium magnetspro se litigationpro se representation
01:02:05
2020 - August (2)
22 Aug 2020 Sat
Clif High / 2020 08 22 - Immigrants Guide To SciFi World - Monkey Shocks
#vitamin d immunityuvb lightufo propulsionace2 receptorsbioweaponboscovichbuckminster fullerelement 115etheric fieldetheric physicsgimbal ufosinstitutional corruptionmagnetic drivespandemic originssun diseaset cellstic tac ufos
00:45:40
03 Aug 2020 Mon
Clif High / immigrant's guide to SciFi World S0E2
#wireless energywar on terrorscientific stagnationacademic inertiaalbert einsteinbrett weinsteinchinae=mc²eric weinsteinether theoryheather hangmichelson morley experimentnikola teslaquantum internetroger boscovich
00:53:07
2020 - July (4)
29 Jul 2020 Wed
Clif High / immigrants guide to scifi world s0e1
#vitamin d deficiencyvatican secretsufo disclosureblender softwareeconomic transitioneric weinsteinglobal chaosgold standard endneodymium magnetsnsa facilitiespetrodollarpure sleepsci fi worldsun diseasethe verdict with ted cruz
00:38:16
27 Jul 2020 Mon
Clif High / Immigrant's Guide to SciFi World - s0 e0
#uvc radiationthree gorgessilver pricesanti gravity technologiesarea 51ccp viruschina collapseclimate changeconspiracy theoriescrypto volatilityeconomic crisisfree energyglobal depressiongold pricesmom experiment
00:47:34
16 Jul 2020 Thu
Clif High / 2020 07 16 critical thinking - #me_twoo
#two factor authenticationtwitter hacksun spark systemaccount takeoveranti gravity technologybackup tapesboscovichcybersecurityinsider threatsopen portspatent illustrationspatent law
00:26:40
05 Jul 2020 Sun
Clif High / 2020 07 05 Risk Assessment & mic check
#uv sterilizationthree gorges damsleep supplementchinese communist partyclimate changeconspiracy theoriescovid 19disaster predictionelectromagnetismice agemasksneodymium magnetsnuclear meltdownspublic healthreturn current sheet
00:47:42
2020 - June (12)
29 Jun 2020 Mon
Clif High / critical thinking 2020.6.29 Masks vaccines & stupid people
#viral loadvaccinessuperstitious fearanti vax movementbig pharmabioweaponbioweaponscovid 19genetic materialmasksmouse genetic materialoxygen intake
00:05:22
29 Jun 2020 Mon
Clif High / critical thinking 2020.6.29 Sets Groups Projections TMs
#temporal markerstechnological accelerationsummer of changeacademic institutionschina forced demolitionconspiracy theoriescovid 19 narrativesculture warfake newsmodern communication technologiespredictive frameworksracial riotsroyalty and elitessets and groupssocial upheavalst louis armed confrontationstrange energies from space
00:31:50
21 Jun 2020 Sun
Clif High / critical thinking - june 21 year zero - cancel scions of slavery
#yalesystemic racismsororitiescambridgecancel culturececil rhodesfraternity systemharvardhigher educationhistorical slaveryinstitutional corruptionivy leagueking charles iiinobel prizeoxfordprincetonqueen elizabeth ii
00:06:48
21 Jun 2020 Sun
Clif High / 2020 06 21 Solstice Day - strange energies from space
#vitamin dsuns coronastrange energies from spacedecember 2039earths orbital yearelectromagnetic radiationgalactic cyclesgamma rayshematitehuman hormonesjuly 2039nuclear fusion reactorplanetary expansionplasma coresproto hormonessolar activity
00:45:26
17 Jun 2020 Wed
Clif High / critical thinking - What I Learned - Words from expert cancer survivor
#vitamin dvaccine safety concernssmall cell carcinomaalternative cancer treatmentsautismbaby boomersbig pharmachaga mushroomchemotherapycolon cancerconventional medicine critiquefenbendazolefenbendazole usegerson therapymetabolic therapymouse brain tissueretroviruses
00:26:44
16 Jun 2020 Tue
Clif High / critical thinking - 2020-6-16 Scifi World Emerges
#vitamin d deficiencyvatican librarytalibanantifaantifa actionsartificial intelligenceconspiracy theoriescontract tracerscorona temperaturehigh energy particleslisp programminglockdownsplangepowers that besecond wave infectionssmithsonian bunkerssolar cyclessolar minimum
00:59:00
14 Jun 2020 Sun
Clif High / critical thinking - June 14, Zero - WooSci - Summer-Year Zer0
#zhong nanshanwuhan labsvitamin supplementationalternative medicineanthony faucibioweapon claimscommunist party of chinacomputer graphics patentsconspiracy theoriesether theorygeopoliticsherd immunityimmune systemparaimunitysars cov 2
00:38:02
12 Jun 2020 Fri
Clif High / critical thinking - 6.12.0 - This shit is dangerous ! BSC DEMO !
#tetrahedronteslaspace travelbolshevik revolutionbuckminster fullerclimate changeenergy storage systemsice agelevitating rvmagnetic explosivesmagnetic field manipulationneodymium magnetsoptical shieldsperpetual motionpolitical ideologiespolycarbonate shieldsroger boscovich
00:32:54
11 Jun 2020 Thu
Clif High / critical thinking - June 11 Year Zero - waves, flotsam, jetsam, lagan, derelict
#year zerovitamin d deficiencyvitamin dbioweapon conspiracydeep statedeep state theoryengineered unrestglobal crisisinfrastructure sabotagelisp programming languagemetabolic syndromesars cov 2useless eatersvatican libraryvitamin c
00:33:37
08 Jun 2020 Mon
Clif High / critical thinking - june 8 2020 - #3 - future history - emotional, driving waves
#year zerovitamin dvatican libraryboscovichcosmic disclosurecovid 19cryptocurrency fluctuationsdebt wintereconomic winterkondratieff forecastnorthern hemispherensapandemic impactsocial collapsesouthern hemisphere
00:17:40
08 Jun 2020 Mon
Clif High / critical thinking - june 8 2020 #2 plan D
#vitamin d levelsvitamin dvitamin ccolon cancer surgeryhuman growth hormoneimmune responselockdownspandemic policypara immunitypfu ratioplaque forming unitpure sleepsars cov 2sars cov 2 outbreakssupplement marketing
00:41:18
08 Jun 2020 Mon
Clif High / critical thinking - june 8 2020 - year zero - fat shock -pure sleep
#sleep optimizationscitechpure sleepanesthetic mechanismsbiochemical recoverycolon cancer surgeryhemp milkhuman growth hormonehyperspacelipid platesmacadamia nut milkneuron cellspsychedelic consciousnesspsychedelic drugs
00:14:19
2020 - April (14)
30 Apr 2020 Thu
Clif High / critical thinking - April 30, Year Zer0 - VDI & SOD OFF
#vitamin d deficiencyvitamin dvitamin cace2 receptorace2 receptor damagebioindustry advancementsc147 cellschaga mushroomcrisprcrispr technologyepigenetic researchgeorge webbhuman growth hormoneparticle to infectious unit ratiopaul cottrellpeptidespure sleepsuperoxide radicalst cellstwo hit kinetics
00:35:11
28 Apr 2020 Tue
Clif High / critical thinking - critical numbers & future history
#vitamin d levelsvitamin dvitamin c levelschinacoronavirus dataflying carsfuture historyglobal conflictmilligram per decaliternanograms per milliliterobesityprocessed foodsreverse engineered technologysaltstanford studysugarsun diseasevitamin c
00:55:16
19 Apr 2020 Sun
Clif High / critical thinking - bioweapon economy
#vitamin cstefan molyneuxprevotellabioweapon conspiracychagacommunist party of chinaconsciousness theorycovid 19david wilcockeconomic restructuringfalkegeorge webbhiv aidshiv aids engineeringjason goodmanmedia censorshippaul cottrell
00:44:27
16 Apr 2020 Thu
Clif High / critical thinking - april 16, 2020 - #2 - Grupen food
#wholesale marketssupply chain disruptionrestaurant supply chainbeetsbioweaponsccpchinese communist partycorncostcoeconomic instabilityfood securityfrozen spinachglobal depressiongroup buyinglocal food networkspeaspizza crusts
00:09:56
16 Apr 2020 Thu
Clif High / critical thinking - April 16, 2020 - MSM vs CCP = #bioweapon
#wuhan laboratoryvitamin cvaccine efficacyace2 receptorsbioweapon conspiracybloombergccpchaga mushroomcommunist party of chinacovid 19covid 19 originsfox newsgain of functiongain of function researchherd immunitymedia censorshippeoples liberation army navy
00:50:46
13 Apr 2020 Mon
Clif High / critical thinking - what they all missed !
#ufossupply chain failurekerry cassidyarea 51ccpclimate adaptationcommunist party of chinacrystallized intelligencedavid ickedeep statedeep state conspiracyfuture society planningglobalization collapsejean baudrillardjordan sederjust in time inventory
00:37:35
11 Apr 2020 Sat
Clif High / critical thinking - #shitstorm - The case for space aliens
#space aliensqeconomic collapse3 rule5gapril 11 2020big agriculturebig financebig mediabig militarybig pharmabig telcosbitcoin halvingccpcontinuity of governmentcryptocurrencydavid ickedeep state
00:39:43
07 Apr 2020 Tue
Clif High / critical thinking - april 7, year 0, smoking bats 6 - The End of the World as we Knew It
#wuhanpublic health crisispandemic disinformation5g conspiracy theoriesalfred weberbioengineered pathogenscarrie cassidychaga teachina bioweapon theorychinese biolabscommunist party of chinaconspiracy theoriescovid 19crispr softwaredavid wilcockelenajason goodmanjsnp4neanderthal extinction
00:25:57
07 Apr 2020 Tue
Clif High / critical thinking - smoking bats 5 - REDUCE VIRAL LOAD
#zinc supplementationvitamin c therapyscurvybioweapon theorychagacovid 19elderberry extracthorseshoe batsmedical malpracticenatures wayprevotella bacilluspsilocybe cubensispure bulk
00:17:24
05 Apr 2020 Sun
Clif High / critical thinking - April 5, Year 0, CCP War, biolabs & batshit
#xi jinpingwuhan labswuhanbioweapon theoryccpchinese communist partycovid 19horseshoe batslung fibrosismedical misdiagnosisprevotella bacillustwitter banventilatorsvitamin cvitamin c therapy
00:42:25
03 Apr 2020 Fri
Clif High / critical thinking - smoking bats 3 - april 3 yr0
#vitamin csocietal collapsesepsisalex jonesauthoritarian controlbioweapon theorycarrie cassidycholeracommunist party of chinaconspiracy frameworkscorey goodedavid wilcockjason goodmanjoseph farrellmad max worldmedical censorshipqanon
00:19:59
03 Apr 2020 Fri
Clif High / critical thinking - april 3 Year 0 - smoking bats 3 first
#year zerovitamin cvirus deniersage of aquariusalex jonesalternative medicinebioweapon conspiracybotsccpchaga mushroomschinese government responsecommunist party of chinaconspiracy theoriescovid 19 originsdavid wilcocksmoking bats 3
00:52:29
02 Apr 2020 Thu
Clif High / critical thinking Apr 2.2020 - Smoking Bats #2
#wuhanvitamin csars cov 2bioweaponcarnivore dietcovid 19disease xerythromycinhantavirusketo dietmechanical oxygenationprevotella bacillusprevotella bacteria
00:35:48
01 Apr 2020 Wed
Clif High / April 1, 2020 Critical thinking - The Smoking Bat...#chaga_gangsta
#wuhan viruswuhan biolabsvitamin c therapy2011 paperbioweapon claimscdcchaga mushroom extractchinese communist partydr paul cottrellhorseshoe batsl ascorbatepseudogene mechanismstwitter account blocked
00:13:40
2020 - March (3)
28 Mar 2020 Sat
Clif High / critical thinking March 28 part Deaux
#starlink satellitesrobrico allegationsbenbioweaponbioweapon conspiracyccp viruschinese communist partyconspiracy theoriescorey gooddirty bombedge of wondergaiageorge webbjames gillianjason goodmanjay weidnerlegal threatsport of charlestonpublic disputes
00:26:59
23 Mar 2020 Mon
Clif High / CCP LIES & YOU DIE
#welded doorstransparencyspain healthcare crisisabc newsauthoritarian measureschinachina pandemic responseerror loading messagesicu casesmedia censorshippandemicspain
00:05:40
22 Mar 2020 Sun
Clif High / critical thinking - Mar 22/2020 - NewWorld - Priorities Planning Projections #chaga_gangsta
#year zerosupply chain collapsesocial order changealmond milkanimal proteinbuckminster fullerccpchina economic impactcommunist party of chinaeconomic relocalizationfeminismfood security crisishoashomeowners associationsjust in time supply chainmarch 22 2020martial law
00:40:36
2020 - February (10)
26 Feb 2020 Wed
Clif High / critical thinking - Feb 26/2020 - SARS2 - Bio-warfare manual - DECONTAMINATION
#xi jinpingsupply chain collapsesars cov 2ace2 receptorsbioweapon conspiracychemical decontaminationcloroxcopper surfacescovid 19government inactionhypochlorite solutionsnuclear biological and chemical warfare manualpandemic preparednessrespiratory arrest syndromerife machines
00:32:40
19 Feb 2020 Wed
Clif High / interview with cliff choi out of hong kong about on ground situation there now - sun disease
#viral originstaiwano fungusr25 reproduction rateace2 entry pointsbitcoinchaga mushroomcovid 19dr cliff choieconomic collapsegenome engineeringh1n1hong konghong kong crisisimmune systemmainland chinapandemic responsequarantine protocols
00:38:38
15 Feb 2020 Sat
Clif High / critical thinking - 2/15/2020 - #covid19 = Sun disease?
#sun diseasequercetinprobioticsaltaalternative medicineasymmetric linguistic trend analysischaga mushroomschlorine dioxidecovid 19 predictionsglutathionegut stormingkaritsummspandemic social changes
00:43:06
13 Feb 2020 Thu
Clif High / critical thinking - covid 19 - what (may) work & why
#wuhan labvaccine skepticismspringback effectalternative treatmentsbioweapon theorycdcchaga mushroomcovid 19cytokine stormsdata suppressionhiv protease inhibitorhubei provincelunar new yearn95 maskspandemic origins
00:49:59
12 Feb 2020 Wed
Clif High / critical thinking - Covid19 - 71 days - expected reactions - supplies list
#vaccine skepticismvaccine efficacysupply chainsbioweaponbioweapon conspiracybleachchinese communist partychinese governmentchinese navycolloidal silvercovid 19covid 19 originscytokine stormsgovernment responsemaskspandemic preparednessregime change
00:45:30
10 Feb 2020 Mon
Clif High / critical thinking - 2-10-2020 #2 - Scum Wars - woo personalities & shit they say!
#ufosone cup one lifemmsalternative medicineascended masterscarrie cassidychlorine dioxideconspiracy theoriesesetiextraterrestrial contactjames gillilandjim humblejordan satherkeishalegal actionmiracle mineral solution
00:34:55
09 Feb 2020 Sun
Clif High / critical thinking - safe assumptions, analysis, suggestions Corona virus (strong sound levels) #cov
#wuhan laboratoryvitamins bpandemic predictions1960s military doctrinealternative medicinebioweapon conspiracyccoronavirus origincrispr markerscytokine stormsdeconomic contractiongenetic engineeringglobal social collapsehiv proteinskeishas gans materialmms
00:43:52
09 Feb 2020 Sun
Clif High / critical thinking - James Gililland is lying about me!
#youtube content moderationyoutube complaintwashington state courtcharacter attacksfebruary 9 2020gaiainciting violencejames gillilandjay wideneronline harassmentslander lawsterms of servicevirtue signaling
00:10:14
08 Feb 2020 Sat
Clif High / critical thinking - corona virus updates conspiracy social consequences spread patterns
#wuhan bioweapon labspanish flupandemic preparednessalternative medicinebioweapon conspiracyc60 in oilcarrie cassidychinese peoples liberation armycoronaviruscoronavirus originscrispr artifactsdr frank plummergerman researchimmune system healthjames gillilandjim humblekeishamms
00:40:52
07 Feb 2020 Fri
Clif High / Critical Thinking - Love in the Time of Cholera
#wuhanwashington statepublic health policyalternative medicinebioweapon theoryboscovich theoria naturalisbritish columbiacarrie cassidychlorine dioxideconspiracy theoriescorey goodedavid wilcockde certatio physica de luminiguangzhoujim humblejordan satherlove in the time of cholerammsoregonpandemic origins
00:44:32
2020 - January (2)
28 Jan 2020 Tue
Clif High / critical thinking - coronavirus, peptides, BDECK, C60 - CHAGA mushroom 4 COVID19
#supplementationserolutinpersonal health responsibilityallopathic medicinealternative medicineanti fragilebdec systembig pharmac60 fullerenescancer preventioncancer wardchaga mushroomchemical industry exposurecoronavirusglandocortice ageimmune systemliposomal vitamin cmetabolic diseasepaul stamets
00:56:16
07 Jan 2020 Tue
Clif High / Critical Thinking Jan 7 2020 What the PLUCK? David Wilcock & Corey Goode correct? CW & Zenn wrong?
#unspiritualityufo propulsionufobilly meyerblue chicken cultchlorine dioxideconspiracy theoriescorey goodecozy revcritical worlddavid wilcockedge of wonderinstitutional corruptionjordan sathernikola teslaqquantum physicsscientific consensus
00:50:43
2019
2019 - November (1)
07 Nov 2019 Thu
Clif High / 2019 11 07 critical thinking - sensitivity to life - for men mostly
#vitamin b3san pedro cactuspsychedelic medicineadolf hitlerconsciousness energycuranderosexperience debrisjoe rogankarma theorymagic mushroomsmercury retrogrademetempsychosisorthomolecular medicineparanoid schizophrenia
00:44:31
2019 - July (4)
12 Jul 2019 Fri
Clif High / critical thinking s0e0
#whole body vibrationrussian cosmonautsrehabilitation18 hertzathletic trainingcancer recoverydeep vein thrombosisearth gravitiesheavy bagshormesishyper vibemuscle hypertrophynikung exercisesoxygenation
00:10:52
02 Jul 2019 Tue
Clif High / cancerwards01e5 part 2
#nitric oxide therapynitric oxidemuscle building exercisesblood drawcancer recoverycancer wardepisode 5exercise ringsfastinggcmaf plusgcmaf plus productshyper vibeimmunotherapyimmunotherapy methods
00:02:53
02 Jul 2019 Tue
Clif High / eceti bans me
#washington state human rights commissionufo phenomenascientific skepticismbelief discriminationconference exclusionconfirmation biascorey gooddavid wilcockdigital camera artifactsedge of wondereseti conferencehuman rights lawjames gillianjordan satherlove and lightnight vision gogglesrcw 4960
00:12:02
02 Jul 2019 Tue
Clif High / cancerwards01e5
#whole body vibrationsuper beets lozengesnitric oxide therapy5gcancer immunotherapycolon cancerelectromagnetic fieldsendothelial healthendotheliumgcmafglycoprotein macrophage activating factorhuman n2 productshunter killer cellshyper vibe
00:31:06
2019 - May (1)
09 May 2019 Thu
Clif High / clifs new canoe
#vr1 ocean canoethulestevecancer recoverycarbon fibergoprohealth recoveryhookiekayakingkevlaroutdoor recreationproduct reviewss glasssteelhead fishing
00:03:13
2019 - February (3)
18 Feb 2019 Mon
Clif High / cancer ward s01e02
#western allopathic medicinevitamin c therapyvitamin cargentinabitcoinc60cancer preventioncatholic archbishopscritical thinking skillscryptocurrency adoptiondavid wilcockgearson therapynuremberg trialsorthomolecular medicineorthomolecular therapyparaguaysolzhenitsynswift
00:42:54
17 Feb 2019 Sun
Clif High / my office
#workplace setuptrenchsauna3d printer600 square foot officeconstruction managementelectricianfinancial frustrationhome renovationlateral arm push upslive streamingradical mastectomy
00:02:27
17 Feb 2019 Sun
Clif High / attitude adjustment- from the Cancer Ward e1 #cancerward #attitudeC
#vitamin c therapythe cancer wardsmith mundt act5g radiationalexander solzhenitsynalternative medicinecancer survivorshipchaga mushroomconventional medicine critiqueenvironmental carcinogensepigenetic damagegut cancerhigh dose vitamin clions maneliposomal vitamin c
00:38:34
2018
2018 - November (1)
14 Nov 2018 Wed
Clif High / c60 + intergalactic- a conversation with Ken (scientist)
#vandenbergtelomere lengthsuperoxide dismutasec60 fullerenesc60 purple powercalifornia wildfirescancer etiologycuridermhartmutt muellerintergalactic interwebkenmitochondrial functionnasaquantum communicationradiation protectionsenescent cellssimi reactorsodstem cell biology
00:43:41
2018 - May (1)
28 May 2018 Mon
Clif High / clifwoojo5282018
#webbotscientific methodremote viewingaltarancel keysbare naked wealthblack seed oilblue avianscopyright theftcorey goodecozy revcrypto forecastingfodmap dietgaia tvjoe from the carolinasjonas salkjordan satherlectin sensitivitypeer review
00:29:10
2017
2017 - August (2)
02 Aug 2017 Wed
Clif High / clif interviews Reggie Middleton -part 2....
#veritasiumvedristoken utilitycontract rentcryptocurrency regulationdigital asset exchangedisintermediationdistressed creditseconomic renteconomic rent theoryjamaica stock exchangemortgage backed securitiespeer to peer capital marketsreggie middletonsmart contracts
00:30:42
02 Aug 2017 Wed
Clif High / clif interviews Reggie Middleton ~ part 1
#white paperveritasiumtone veybmwdecentralized financeentity tokenethereum networkgeneral electricinitial coin offeringsinstitutional tradinginvestment banksmarket makersover the counterpeer to peerreggie middletonsmart contractstoken economics
00:38:20
2017 - July (2)
28 Jul 2017 Fri
Clif High / Clif interviews Steve Nico Williams! Raw interview!
#xbrlsteve nico williamssmart contractscryptocurrencydefidun and bradstreeterc 20erc 23financial inclusiongithubinvoice factoringipfsmoodyspokenspopulistpopulousppt
01:26:00
16 Jul 2017 Sun
Clif High / clifs wujo July 16, 2017 Moving, Populous, Vid theft, cryptos
#washington coastveritasiumsmall business financebitcoinblockchain technologybusiness relocationcliff wujocryptocurrency marketsdigital artifactsdigital content protectionencrypted codechalf past humaninvoice factoringmcclees automotivepopulous
00:26:24
2017 - June (1)
17 Jun 2017 Sat
Clif High / How to safely register your ENS name! Yes, bad sound!
#snipingsmart contractsmyetherwalletblind auctionblockchain securitycryptocurrency tradingdigital identitydistributed applicationsenseth domainsetherethereum name servicegas feesgas pricegigaweimetamask
00:24:16
2017 - May (2)
28 May 2017 Sun
Clif High / Crocodile cryptos and pissin' in the woo-woo pond (sans annoying title)
#webbot datajay widenerjames coreyamy semple mcphersonbip 148bitcoin protocolchemtrailsconspiracy theoriescorey goodecrocodile teeth patterncryptocurrencydavid wilcockfederal reservefinancial systemsfrench revolutionguy mtvhyperinflation
00:35:17
26 May 2017 Fri
Clif High / may 26 2017 wujo - cryptos no bubble, temporal markers
#wealth transfertemporal markersroman empirebitcoincapital flightcrocodile teethcryptocurrency bubblesfederal reservefomogenghis khangold seizureshyperinflationopium warsprivate keys
00:26:08
2017 - April (6)
20 Apr 2017 Thu
Clif High / Alt Realty #4 - Not flat earth! Top 5 human reasons why!
#world war itwitterspace explorationballistics physicscelestial navigationcliffdart missionflat earth theoryomega 3omega 6omega 9omega fatty acidsover the horizon radarparis gunrichard hoagland
00:04:48
16 Apr 2017 Sun
Clif High / Welcome to Alt Reality #5 - Sun, chemies, and You!
#woo woosunsolar quiescenceamphibian lifeastrologychemtrailsconspiracy theoriescorey goodecosmic raysdavid wilcockdeep statedonald trumphalleys cometice agejupiterradiation hazardssaturn
00:19:48
08 Apr 2017 Sat
Clif High / Welcome to Alt Reality (#3): Silver, resistance is futile!
#silver price forecastsilverpullbackapril 18thbitcoinbitcoin analysisgeopolitical eventsgeopolitical speculationgoldmarket projectionsmarket volatilitymay breakoutprecious metalsprice resistance
00:08:46
08 Apr 2017 Sat
Clif High / Welcome to Alt Reality (#2) - Fix for Youtube!
#youtube partner programyoutubeview thresholdclickbaiterscontent theftcopyright enforcementcryptographic hashdigital asset idlegacy mediaplatform competitiontig welding torch
00:18:11
05 Apr 2017 Wed
Clif High / Welcome to Alt Reality, and what to do about it!
#youtube advertisingwhite supremacywall street journalalternative revenue modelsalt right movementberlin wallbitcoincliff schoolcnncreator economycreator schoolslegacy mediamedia censorshipmsnbcnegative selection tools
00:32:24
01 Apr 2017 Sat
Clif High / Visit to the trimaran - April 1, 2017
#water tankstrimaran constructiontrimaranama areaboat renovationchart tabledagger boardepoxy paintfreezer refrigeratorgel coatinterior designmarine engineeringpilot house
00:07:01
2017 - March (7)
30 Mar 2017 Thu
Clif High / clif's wujo - March 30, 2017
#youtube tv on demandyoutube advertiser boycotttwittercentral banksclickbaitcnncontent moderationdeflationary pressuresfacebookflash crashesgoogleisis associationslinguistic analysismarket collapsemonetization strategiesmsnbcsocial media advertising
00:21:55
26 Mar 2017 Sun
Clif High / clifs wujo March 26 2017 Advertising bites it on social.
#world war itwittersocial media censorshipadvertiser boycottsalex jonescivil warconservative mediaemotional biasfacebookglobalist languagegooglemarketing strategypolitical correctnessprogressive speakrevolutionary war
00:16:20
24 Mar 2017 Fri
Clif High / clifs wujo - march 24, 2017 Rain and the damn dams!
#seismic activitiessacramentoproductive farmlandcalifornia floodingcapitol stepsclimate changeenvironmental diasporaenvironmental migrationhydroelectric plantsinfrastructure failureland shiftingnatural disasterspineapple express
00:04:51
24 Mar 2017 Fri
Clif High / clif's wujo - March 23, 2017 - EM50 studio, vid theft, censorship, bitcoin
#youtubewebbot radiotwitterad revenue theftalgorithmic biasbitcoinbitcoin hard forkcliff highcopyright infringementdigital advertisingem50google pluslinguistic analysissocial media censorshiptai lopez
00:19:09
24 Mar 2017 Fri
Clif High / clifs wujo - march 24, 2017 bitcoin, 3 (or more) alternatives
#segwitsegmented witnessprimary blockaccumulator counterancillary blocksbitcoinbitcoin scalabilitybitcoin unlimitedblockchain technologyblock sizecryptocurrencyhard forkslateral scalabilityminers
00:05:33
24 Mar 2017 Fri
Clif High / clifs wujo - march 24, 2017 consciousness and thoughts for those contemplating suicide
#veteranssuicide and afterlifesuicideawarenessciaconsciousnessconspiracy theoriesfifth densityhamletkarmakarmic progressionmeditationnature of consciousnesspsychedelicspsychedelics and meditation
00:09:33
23 Mar 2017 Thu
Clif High / Welcome to the halfpasthuman.com EM50 mobile video studio
#video studiovideo productiontruck1997 gmc motorhomeequipment setupfootage editinggmc coachmotorhome conversionproatractor
00:00:52
2017 - February (1)
11 Feb 2017 Sat
Clif High / The attack of the big G spot!
#youtubetech monopoly powersilveradsensealgorithmic censorshipalternative mediabitcoincasey neistatconspiracy theoriescryptocurrency regulationgatagoldgooglepandapenguinpizzagatert
00:22:20
2017 - January (2)
28 Jan 2017 Sat
Clif High / clif's wujo - Mandela Effect, AI, Quantum computers - Janary 2017
#texasstephen bikoquantum noiseartificial intelligencecernchinaconsciousnessconsciousness fieldd waveeast coastgooglehollywoodmandela effectnasanelson mandelaquantum computing
00:49:54
12 Jan 2017 Thu
Clif High / clif high wujo January 12, 2017
#western medicineus dollarice agealternative medicineantarcticaayurvedabitcoinchinese authoritiescliff highclimate forecastscryptocurrency marketsdonald trumpeconomic hyperinflationglobal context changehalf past human
00:23:00
2016
2016 - December (2)
12 Dec 2016 Mon
Clif High / dec2016wujo - Deep Woo, spirit cooking, and you.
#spirit cookingskull and bonesreincarnationcerncern predictionsconspiracy theoriesflax seedfreemasonryfulvic mineralslarge hadron collidernew age beliefspizzagatepodesta emails
00:41:15
04 Dec 2016 Sun
Clif High / Warning to Woo-Woo! Google's War against Words!
#youtubewoo wooufosadvertising revenuealternative mediaalt rightcorporate censorshipfake newsgooglehillary clintoninstagramredditsearch algorithmssteemittwitter
00:12:12
2016 - November (2)
19 Nov 2016 Sat
Clif High / wujo11182016
#united statestrump inaugurationsupply chain collapsealta reportamerican dollar empirecredit freezedollar hegemonyeconomic recessionegyptfederal reservehealthcare monopolyindiajust in time supply systemnorth americaobama regime
00:12:02
11 Nov 2016 Fri
Clif High / Wujo on structured water.
#water moleculesvortex effectsstructured water3d printingchaliceschemtrailscovalent bondsdynamic equilibriumelectromagnetic influencesenergy fieldsfluorescent bulbsinterstellarcomjerry durandolympia washingtonplastic bottles
00:12:13
2016 - October (2)
19 Oct 2016 Wed
Clif High / OCT19Alta
#zimbabwevenezuelashadow governmentbitcoinchinadebt bubbledeep statedonald trumpdow jones industrial averageeconomic collapsefederal reservegoldhillary clintonhyperinflationindonesiajekyll island plotmalaysiarussiasaudi arabia
00:18:06
12 Oct 2016 Wed
Clif High / Is this THAT weekend? Hillary missing! BTC rising! Politics fracturing! Fed failing!
#ufo sightingsufosspace aliensbitcoinbitcoin forecastingchinese investorscrocodile teeth patterncryptocurrency trendscurrency devaluationdroneseurasiagoldgold and silverhillary clintonoctober 11th 2016silversound money
00:18:42
2016 - September (5)
25 Sep 2016 Sun
Clif High / non debate debate : destruction of illusion!
#yieldstuesday morningpresidential debatesbondsbond vigilantescentral bankseconomic chaosfinancial marketsfiscal chaosglobal marketshillary clintonimmediacy datainterest ratesmonday afternoonoctober storm
00:04:22
21 Sep 2016 Wed
Clif High / 81.75% conv. rate on Twitterads!
#weighted word cloudufostwitter policyalgorithmic censorshipalgorithmic prioritizationchemtrailsconspiracy theoriesdigital fascismdigital marketing strategyengagement rategoogle adwordshillary clintonmarketing policysocial media advertisingtwitter ad campaign
00:43:29
20 Sep 2016 Tue
Clif High / Body doubles? CGIHillary? Is Hillary dead?
#sound moneysolar panelssilver shortagebitcoinbond crisiscentral bankingconstitutiondonald trumpeconomic instabilityelectric vehiclesequity crashfederal reservegold and silverhillary clintonseptember 11
00:11:05
12 Sep 2016 Mon
Clif High / wujo to briefly discuss #HillaryFainting
#social bodyseptember 11thhillary clintonalta reportsbody doublechelsea clintonconspiracy theoriesdeep data miningdigital surveillancedollar empireeconomic collapseelection integrityemotional sums enginehalfpasthumancomhealth claims
00:06:59
01 Sep 2016 Thu
Clif High / How i screwed up and pissed off Google!
#twittertrademark symboltrademark lawadvertising regulationsadwordscliff highcost per saledigital marketinggeneric termgooglehalfpasthumancomintellectual propertypredictive linguisticsreturn on investmentsearch engine policy
00:10:09
2016 - August (7)
26 Aug 2016 Fri
Clif High / Web Bot Hits #1
00:00:30
20 Aug 2016 Sat
Clif High / 3 reasons to read web bot reports
#webbot reportspuerto ricopredictive linguisticsbitcoinbitcoin adoptioncruise ship firedeep data miningdisaster preparednesseconomic forecastingeconomic stressfinancial crisisinflationinflation risklouisiana flood wall
00:09:08
19 Aug 2016 Fri
Clif High / How to Breathe Free in a Chemtrail world.
#upper atmosphereslurrypublic healthalternative mediaalto reportchemtrailsconspiracy theoriesgeoengineeringhalf past humaninternet nutjobsmainstream newsmicrofine metalsprotect health
00:01:21
18 Aug 2016 Thu
Clif High / web bot future forecasts updates august 18 2016
#webbotus political fractureusa pop modelalta reportsbanking crisisbitcoinbitcoin price forecastcliff barhigheconomic collapsegeopolitical instabilityitalian bankingnew electricssiberian coal minesturkey explosions
00:07:20
18 Aug 2016 Thu
Clif High / followmeontwitter
00:00:29
18 Aug 2016 Thu
Clif High / how i went from zero to 22.93% conversion rate on twitter ads in 1 wk.
#twitter advertisingtwitter adssql queriesaffiliate feesaffiliate marketingamazon storecliff highconversion optimizationconversion rateemotional targetingemotive reduction enginehalfpastumancomlexicon adjustmentpredictive linguisticsself selecting audience
00:14:43
05 Aug 2016 Fri
Clif High / clifwujo852016
#vaticanturkeysilverbitcoinclimate oscillationconvection systemcrack up boomeconomic collapsefalse flag eventsfederal reservefood securitygalactic cyclesgoldgreenhouse farmingice agejuly unrestmarket manipulationpowers that be
00:22:55
2016 - July (4)
27 Jul 2016 Wed
Clif High / clif's wujo 7-27-16
#won to bitcoin ratevatican bank scandalunited states dollarair gapsaugust 2016bitcoinbitcoin price predictioncurrency exchange rateseconomic indicatorsgoldgold and silver marketsjanuary 2017price thresholdssilver
00:18:14
14 Jul 2016 Thu
Clif High / AnotherThursWujo
#summer of chaossocial unrestsilveranonymousbitcoinbitcoin price predictionday of ragedollar devaluationeconomic crisisgoldgold silver ratiojuly 15thmarket volatilitypike place marketprecious metals tradingseattleshanghai arbitrage
00:12:31
09 Jul 2016 Sat
Clif High / wujo782016
#tacomasmith mundt actsilverbitcoinboston harborcryptocurrency marketseconomic forecastinggoldjuly 12thlinguistic analysismaritime logisticsmarket devaluationprecious metalsshort selling
00:10:04
09 Jul 2016 Sat
Clif High / trimaran 07 08 2016
#west bay marinawashingtontrimaranboat dockingdeschutes rivergel coatmarine operationsnautical navigationnisqually indian buildingnisqually tribeolympiapriest point parktie lines
00:15:38
2016 - June (1)
15 Jun 2016 Wed
Clif High / truckwujo 6152016
#visionariestrimarantechnology adoptionbitcoinbitcoin price predictioncascadescitadel marineclimate anomaliescrossing the chasmearly adoptersgoldmainstreamnueve crystalspacific northwestprecious metalssilver
00:27:28
2016 - April (1)
15 Apr 2016 Fri
Clif High / clifwujo4152016
#uv d classificationterra entitytacomabitcoinbitcoin analysiscapital controlsclimate forecastingcurrency crisisdeutsche bankgoldhyperinflationpopcorn stormsprecious metalssilver
00:24:05
2016 - March (2)
26 Mar 2016 Sat
Clif High / Clif drives the north shore (hood canal) road part deaux.
#surveillanceprivacylistenercameras
00:12:12
16 Mar 2016 Wed
Clif High / clifswujo3162016
#supply chain failuresovereign debtssilver price limitsbank failuresbitcoincoastal areascomex marketdrug shortageseconomic collapsefinancial crisisgold pricesjust in time deliveryluxury propertiesmount rainiernatural disasterspaper bondspolitical instabilitypopcorn stormsreal estate crash
00:26:35
2016 - February (1)
11 Feb 2016 Thu
Clif High / clifwujo2112016
#super bowlsound moneysilverbioreactive agentsbitcoinchemtrailsdebt based currencyeconomic collapsegeoengineeringgoldhyperinflationjust in time deliveryluke wilsonself reliance
00:46:40
2016 - January (4)
29 Jan 2016 Fri
Clif High / clifswujo1292016
#supply chain disruptionpharmaceutical industrymedical rationingallopathic pharmaceutical industrybaltic dry indexcork floating approachderivatives crisiseconomic collapseesoteric drugsfiat currency devaluationfinancial crisisfood criseshalf past humanhyperinflation
00:24:42
23 Jan 2016 Sat
Clif High / hphdiscoveryvid1
#starship coilsrodin coilsquantum physicsalternative physicscerndark matteretherferrofluidfree energyhalf past humanmagnetic monopolesmaker movementmarco rodinperpetual motion
00:19:23
10 Jan 2016 Sun
Clif High / bornseries
#subunitssoul structurereincarnation theorydoersdouble helixesoteric numerologyfrench revolutionheaven and hellincarnation cycleskarmic consequencesmasonsmetempsychosisminor arcananikola tesla
00:14:39
10 Jan 2016 Sun
Clif High / triune humans and the vortex of time
#wujothinking and destinythinker knower doerblack sundark sungalactic cyclesgolden ageharold percivaliron agekali yugametempsychosisminor arcanamonotheism declinephenolic resinpsychic powersreincarnation theoryschwarzschild sunsilver agestar coils
01:06:51
2015
2015 - December (5)
23 Dec 2015 Wed
Clif High / Dec232015BTC
#yurt studious dollartin2016bitcoinbitcoin forecastingdata analysisdecember 23rdeconomic collapsegoldmarket dysfunctionolympia washingtonpaper debt debacleprecious metalssilver
00:30:12
20 Dec 2015 Sun
Clif High / haboo1 p2
#vietnam wartwin towerspsychological operationsapollo incbaldiconspiracy theoriescorporate ethicsgeorge bushgovernment accountabilitymax kaisermen who stare at goatsmilitary historyolympia washingtonoverstock
00:14:21
20 Dec 2015 Sun
Clif High / haboo1 p3
#war across timereincarnationolympia washingtonancient egyptapollo incbarack obamabrutusconspiracy theoriesdavid wilcockedgar caseyelemental phenotypesfacial recognitiongeneral baldymilitary surveillancenataron
00:19:39
20 Dec 2015 Sun
Clif High / haboo1 p1
#wujovladimir putintlingitalternative mediaconspiracy theoriescopyrighted fictionfictional narrativeshabooimmortality conspiracyindigenous languagejapanese wordkaiser reportmax keisermedia literacysalish languagesquamish
00:06:52
19 Dec 2015 Sat
Clif High / clifhighwujo12182015
#us dollarspiritual afterlifesilverartificial intelligencebitcoinbitcoin price predictioncarmenschannelersconsciousness and reincarnationcopperfinancial collapsegoldkarmanskarmic mechanismsmagnesium tin alloysmagnetic stiltsmetals market analysismetem psychosispaper debtparanoid schizophrenia
01:01:31
2015 - October (3)
08 Oct 2015 Thu
Clif High / HPH update 1082015
#triaxial fiberglasssilver data setsprecious metals analysiscarbon fiber collarscarbon fiber manufacturingcircular utility tubescommodity price predictioncurrency fluctuationsdecember 15theconomic instabilityfood supply issuesgold data setsnovember 12th
00:15:34
07 Oct 2015 Wed
Clif High / OctHPHUpdate
#venturi effectsustainable gardeningrocket mass heateralternative energycarbon fiber rudderschemtrailsclimate adaptationclimate batterycontainer gardeningelectric gardengrow domehomesteading projectsmorning glory vinesoff grid livingproa boat
00:06:31
07 Oct 2015 Wed
Clif High / OotP2
#silver price trendssilver pricesproa boat6061 aluminumama outriggerboat constructioncarbon fiber cranecarbon fiber engineeringclimate change dataelectric motorsfoil sleeveshydroplaningjoy operating forcelaunch support system
00:11:16
2015 - August (2)
10 Aug 2015 Mon
Clif High / clifswujo892015
#yurt livingyuan devaluationtranshumanist candidate30 foot sailbaltic birch plywoodboat constructioncarbon fiberchinese presscrab claw mastcurrency devaluationfinancinggold importshand layuppresident of the united statesproa boatproperty acquisitionsalish surreal studiosilver importstranshumanism
00:14:27
07 Aug 2015 Fri
Clif High / 20150807 – Clif High Audio #29
#wells fargoterra entitysun diseasebitcoinclimate catastrophefinancial collapsegeopolitical fragmentationgrand canyongushawaiijust in time deliverykabullondon banking tiesmanufacturing disruptionmrs wongphoenixresource scarcity
01:16:03
2015 - July (1)
17 Jul 2015 Fri
Clif High / 20150717 – Clif High Audio #28
#waking upunique identitytrue selfconsciousnessdrug useidentityi nessnames as labelsselfhoodselfnesssleep deprivation
00:01:30
2015 - May (1)
05 May 2015 Tue
Clif High / Little Bloop Theory, Universe, Matterium, Humans, Time and Space
#wujowebbot projecttime travel impossibilityadrenal glandsalternative cosmologybig bang theoryconsciousness locationhalfpasthumancominstantaneous travelkerry cassidylittle bloop theorymateriumnegative hydrogen ionsreincarnation theorysean david mortonstring theory
00:56:38
2014
2014 - December (1)
18 Dec 2014 Thu
Clif High / WASFB#2
#traveler railspider foamrudder castingboat constructionbruce foilcarbon fibercomposite materialscrab claw systemdixon dickinson diesel stovediy engineeringescape hatchesfiberglassglue lam beamlexan coversmarine fabrication
00:07:57
2014 - November (1)
01 Nov 2014 Sat
Clif High / dirtypigs
#verbal abusespeakerpersonal insultsdirty pighostilityinsult
00:00:08
2014 - October (1)
16 Oct 2014 Thu
Clif High / 20141016 – Clif High Audio #27
#wujovitamin c therapytaoist medicinealternative medicineayurvedic medicinebritish petroleumcerapeptaseconspiracy theoriesebolafibrinfukushima disastergeneral electrichemochromatosishuman consciousnessliposomal vitamin cmeet daveoblivionseropeptasesystemic enzymes
01:11:06
2014 - July (1)
27 Jul 2014 Sun
Clif High / 20140727 – Clif High Audio #26
#victor schaubergerus dollarthird eye chakraalternative medicinebrahma chakrachakra observationchemtrailsconsciousness theoryeconomic collapsemagnetic reversalpuget soundsean david mortonsolar anomaliesspiritual meditationstructured watersustainable living
00:27:11
2014 - June (1)
21 Jun 2014 Sat
Clif High / IDIR6212014FlyingNaziEconomy
#precious metalspeoples bank of chinapbocantarcticabifurcated currencyconspiracy theoriescurrency systemsdaleksdata integrityfinancial forecastsflying nazisgeopolitical conflictshyperinflationimmediacy data intelligence reportmax kaiser
00:32:18
2014 - May (6)
28 May 2014 Wed
Clif High / IDIR5282014
#watergatespace explorationsilver gold parityanti gravityblack swan eventbull marketchemtrailsconspiracy theoriesdried meat recalleconomic collapsegold silver marketsmarsh incidentpsychic leaksseed germination
00:44:15
18 May 2014 Sun
Clif High / IDIR5182014
#swirly thing eventslinkspacific northwest earthquakeactive volcanoescurrency collapsedollar sell offeconomic downturnfederal government layoffsfood inflationfood price inflationgeological disastersgold and silver pricesgovernment instabilityhousing crashimmediacy data intelligence reportmay 18 2014november 2014
00:25:49
11 May 2014 Sun
Clif High / Boatshed5112014
#woodworking techniquesvacasustainable constructionboat buildingcarbon fiber cranescatamarancatamaran designdiesel electric motorfoilsgeodesic egg shapehydronic systemsmaple door skinsmarine engineeringokoume plywoodpacific proarudderssouth puget sound
00:17:37
11 May 2014 Sun
Clif High / IDIRMay112014
#zionist central bankus dollarukraineanglo american empirebitcoinchinacia backed ukrainian forcescurrency suppressionfinancial marketsgeopolitical conflictgoldimmediacy data intelligence reportpotentiometer metricreal estate bubblesscales of justicesilver
00:18:53
08 May 2014 Thu
Clif High / sailblade vid1
#sailboat riggingsailbladeroblineballistic nylonboat constructioncenter of effortdinel dux ropefiberglass clothgrowdomehydrofoil technologyhypalon paintkayakkayak designklein fogelman foilmarine engineeringmizzen sailphenolic resin
00:06:01
06 May 2014 Tue
Clif High / IDIRMay62014
#victorstalinsilver3d printingcivil unrestclimate changeeconomic collapseglobal coastal eventgoldgovernment purgesgrassroots technologygusmaomccarthy erapeacekeeper apppie and revolutionplanetary expansion
00:21:46
2014 - April (4)
30 Apr 2014 Wed
Clif High / IDIR4302014
#vladimir putinus dollarukrainebank bail inbarack obamabitcoincryptocurrencyeconomic forecastingfinancial crisisgeopoliticsgoldimmediacy data intelligence reportprecious metalssilver
00:13:05
28 Apr 2014 Mon
Clif High / IDIR4282014
#wimbledonukraine warukraineanglo american empiredebt monetizationextreme weatherfederal reservefinancial collapsegoldimmediacy data intelligence reportjune 20thpotentiometerprecious metalspredictive analyticssilver
00:48:32
26 Apr 2014 Sat
Clif High / BuddPaddle
#scare tacticpublic spacepublic safetybulliesbullying preventionconflict resolutioneast sidephotos
00:17:31
21 Apr 2014 Mon
Clif High / clifs wujo (vid 1) April 21, 2014
#ukrainesilver and gold pricespaper debt9 11alternative mediabundy ranch standoffchemtrailscliffs wujocliff underbarconspiracy theoriesfinancial collapsefukushima disastergeopolitical conflictimmediacy data intelligence reports
00:51:17
2014 - March (1)
07 Mar 2014 Fri
Clif High / 20140307 – Clif High Audio #25
#ussupply chain failuresourdough baking10x labsbitcoinchinaclimate oscillationeconomic collapsefinancial warfarefukushimageological instabilitygold priceshanford nuclear sitehyperinflationjust in time supply systemsrussiasilver prices
00:47:24
2013
2013 - December (3)
18 Dec 2013 Wed
Clif High / 20131218 – Clif High Audio #48
#trans pacific partnershiptpprothschildsbank of chinabitcoinbitcoin adoptionbowerscentral bank conspiracyconspiracy theoriescryptocurrency regulationeconomic collapsefederal reservegmosiraqi dinarred shieldsrenminbireptilians
00:42:32
16 Dec 2013 Mon
Clif High / 20131216 – Clif High Audio #47
#silverquarkcoinprecious metalsbill stillbitcoinbitcoin dominanceconspiracy theoriescryptocurrency scamseconomic controlfederal reservegeorge uregoldiraqi dinarmax kaiserpeter schiff
00:29:45
12 Dec 2013 Thu
Clif High / 20131212 – Clif High Audio #46
#smart contractssilvermulti bitarmorybitcoinblockchainbtcqtcoinbasecryptocurrencydigital walletsfederal reservefiat currencyfinancial sovereigntygoldmt gox
00:43:05
2013 - November (3)
24 Nov 2013 Sun
Clif High / 20131124 – Clif High Audio #45
#zionist bankersswiftnsa911american empirebitcoinciacryptocurrencydavid ickeeconomic resistancefiat currencyfinancial eliteslitecoinmichael tassarian
00:36:11
19 Nov 2013 Tue
Clif High / 20131119 – Clif High Audio #44
#zionist controlveritasstrange universebitcoincentral banksterschinacryptocurrencyfiat leakfinancial controlfree marketsglobal currencyheinrich the humanmel fabergasponzi schemered eyes creationsrenminbisean david morton
00:26:28
14 Nov 2013 Thu
Clif High / 20131114 – Clif High Audio #43
#saunarocket mass heaterradiation healthalternative energybitcoinbitcoin adoptionbitcoin magazineblockchaincentral bankcentral bankingchernobylfinancial scamsgeodesic domeiraqi dinark pro 2microsoft stock
00:53:27
2013 - October (2)
23 Oct 2013 Wed
Clif High / 20131023 – Clif High Audio #42
#the streamtaoismsushumna tubealternative medicineastragalus rootayahuascachakrasconsciousness statesdualityenergy balancingfukushimaionizing radiationmescalinemula daharanuclear radiationshoshonaspiritual meditation
01:10:37
10 Oct 2013 Thu
Clif High / 20131010 – Clif High Audio #41
#wujo softwaretemplar numerologytavistock institutealternative reality disorderaztec numerologybitcoinclimate changeconspiracy theoriescouncil on foreign relationsdavid ickedread pirate robertsfederal reservefukushimagovernment defaultinca numerologymax kaisermaya numerologysilk road
01:13:36
2013 - August (1)
26 Aug 2013 Mon
Clif High / 20130826 – Clif High Audio #40
#zionist banksterszeta reticulizecharia sitchinanunnakibitcoinbreakaway civilizationclimate changecomet isonconspiracy theoriesfinancial collapsegeological catastrophenancy laderhosennibirupacific northwestplanetary expansionsumerian cuneiformzahi hawass
00:55:31
2013 - July (3)
29 Jul 2013 Mon
Clif High / 20130729 – Clif High Audio #39
#passive house standardspassive house constructionorbital mechanicsclif highclimate changeconspiracy theorieseconomic inequalityground source air heatinghinomoto tractorice agekansas navymiddle class decline
00:47:58
22 Jul 2013 Mon
Clif High / 20130722 – Clif High Audio #38
#proa boatnuclear safetylinguistic watermarks2013 grape harvestalta reportalternative energybank of americacindy liu effectclimate changedata processingearth to air heat exchangefederal reservefukushima incidentintellectual propertyjp morgan
00:48:48
06 Jul 2013 Sat
Clif High / 20130706 – Clif High Audio #37
#taoist qi medicinesolar radiationred rad tide10x labsalternative medicineayurvedic medicinebioremediationchemtrailsdecentralized powerdinoflagellatesenvironmental degradationfukushimahood canalkalemox fuelnuclear contaminationpiezoelectric energyplutoniumpuget sound
00:34:57
2013 - June (2)
09 Jun 2013 Sun
Clif High / 20130609 – Clif High Audio #36
#resource harvestingnicholas talibmongol empirealternative housinganti fragilitychemtrailscybersecurityfinancial systemsgit processesgreen chainip tunnelingjustice log homemax kaiser
00:44:06
02 Jun 2013 Sun
Clif High / 20130602 – Clif High Audio #35
#yurtsskagit river valleyshort salesbelgian researcherschemtrailsclif highddos attacksearthquake predictionsfarsightorgfukushimaglobal catastrophehawaii remote viewers guildigorinternet infrastructurepacific northwestreal estate crisisremote viewingself fulfilling prophecy
00:39:06
2013 - May (1)
04 May 2013 Sat
Clif High / 20130504 – Clif High Audio #34
#tsunamissun diseasesolar system shiftsbanda acehdisplacement wavesearth expansion theoryfarsightorgfort jesus mombasaglobal coastal eventhood canalnuclear plant failurespacific northwest earthquakepacific plateplasma expansionpuget soundremote viewing
01:41:50
2013 - April (2)
03 Apr 2013 Wed
Clif High / 20130403 – Clif High Audio #33
#walter cronkitesilk roadsatoshisbankstersbitcoincentral bankingciacoinbasecryptocurrencyeconomic collapsefinancial sovereigntygrow domehyperinflationmossadmt goxmulti bitpacific northwestproof of work
00:57:47
01 Apr 2013 Mon
Clif High / 20130401 – Clif High Audio #32
#thriveswift wire transfersean david mortonbitcoinbitcoin skepticismchemtrailschemtrail theorycyprusdavid wilcockdouglas j hagmaneconomic collapsefoster gamblefoster gamble critiqueglobalist controlilluminatiilluminati conspiracyiraqi dinarnassara plan
01:16:02
2013 - February (1)
09 Feb 2013 Sat
Clif High / 20130213 – Clif High Audio #31
#un climate refugeessean david mortonroland emmerichancient historyanunnakiastrologybible translationsclimate changeconspiracy theoriesgobekli tepehealth adviceilluminatimauro biglinopacific platepolar vortexreligious texts
01:01:11
2013 - January (3)
23 Jan 2013 Wed
Clif High / 20130123 – Clif High Audio #30
#tavistock institutesmith mundt actshivaanonymousbankstersclif highconspiracy theoriesdogon creation storyearth changesesoteric beliefsinformation warfarejanuary 6kumbha melamartial arts philosophynummo beingspowers that beself actualization
00:44:53
05 Jan 2013 Sat
Clif High / 20130105 – Clif High Audio #29
#warp drivesteslaspirulinacarrie cassidyendurance modegeocachingglobal coastal eventimpact diamondsiradia couplejerrymagnificent sevennew electrics eraover unity energypost war rebuildingrocket mass heatersavior sciencesiberian precursor
00:35:40
01 Jan 2013 Tue
Clif High / 20130101 – Clif High Audio #28
#taoist literaturesmart gravityquantum physicsajnaanubig bangcernchakra meditationconsciousness studiesdark mudraskale pazlarge hadron colliderlittle bloop theorymartyrsmind controlmuladharanegatively ionized hydrogen atom
00:44:15
2012
2012 - December (2)
06 Dec 2012 Thu
Clif High / 20121206 – Clif High Audio #27
#systemic collapseshadow governmentreality creationbrzezinskichakrascouncil on foreign relationscouncil on fucked up relationsderivative explosionearth changesexopolitical warhyperinflationlittle bloop theorynew world orderoccams razorqueen of england
00:58:28
04 Dec 2012 Tue
Clif High / 20121204 – Clif High Audio #26
#third eyespleen chakrasolar plexusbardo statechakraschakra systemconsciousness energycrown chakraelectrosmogelectrosmog effectseva wongganges festivalharaheart chakraholographic realityhui ming chingmeditation practicesmerkabamulahadra
00:44:21
2012 - November (4)
25 Nov 2012 Sun
Clif High / 20121125 – Clif High Audio #25
#world guardsworld government of world citizensworld governmentagenda 21charles hapgoodcoast to coastcommon law systemcrimes against humanitycrustal shift theorydecember 21stdrunvalo mithizdikkathymerkabahplanetary expansionun
00:50:32
21 Nov 2012 Wed
Clif High / 20121121 – Clif High Audio #24
#world government of world citizensworld governmentthomas painecommon lawcourtney browndavid wilcockfemagary davisglobal coastal eventhurricane sandyjimmy savilekathymukakuraination state critiquepapa bushpost catastrophe survivalprince charlessands of timesean david morton
01:08:09
18 Nov 2012 Sun
Clif High / 20121118 – Clif High Audio #23
#zionist movementwinter of hellsilver pricesclimate changeconspiracy theorieseconomic collapsegaza conflictgold pricesjippo loggersland acquisitionlincoln county oregonpacific plate rupturepedophilia networkpermaculture universityplanetary expansionpope ratzinger
00:52:36
10 Nov 2012 Sat
Clif High / 20121110 – Clif High Audio #22
#vedic mathematicssustainable livingrocket mass heateralternative medicineamino acidsancient civilizationschakra systemchemtrailsclimate changeconspiracy theoriesdaniel burishdavid wilcockdr bott modelfukushimageorge kavasiliusmudraportland cement
01:00:45
2012 - October (2)
14 Oct 2012 Sun
Clif High / 20121014 – Clif High Audio #21
#stone books workssocietal collapsereptilian forcesagenda 21bataan death marchbritish royal familycarrington eventchemtrailsconspiracy theoriesdrasbucheeconomic crisisgold and silverkabbalistsnatural newsnew world orderpope benedict xvipreparedness
01:00:30
08 Oct 2012 Mon
Clif High / 20121008 – Clif High Audio #20
#tavistock institutepedophilic child rapist networknew age spiritualitychemtrailingchemtrailsconspiracy theoriescouncil on foreign relationsdavid ickedr richard allen millerglobal financial crisisgovernment censorshipgulper forumhyperinflationjay widenernano aluminum particles
00:48:37
2012 - September (2)
13 Sep 2012 Thu
Clif High / 20120913 – Clif High Audio #19
#tavistock instituterothschildsrockefellersanunnakiconspiracy theoriesfremenglobal conflictgodlike productionsjain cosmologykhazarian hebrewmauro biglinomental healthnebishreligious criticism
00:48:01
03 Sep 2012 Mon
Clif High / 20120903 – Clif High Audio #18
#wujowoo woo artsterence mckennaalcohol stovescitrix arrayeschatonevolutionary complexityfarsightorgfema campsglobal systems collapsehuman consciousnessigorindras netjust in time systemsmicrogreenspost grid survivalremote viewing
00:56:47
2012 - August (2)
11 Aug 2012 Sat
Clif High / 20120811 – Clif High Audio #17
#woo woo artstime perceptionspiritual healing22 trillion times per secondconsciousness theorycontinuous creation destruction modelkali yugakaryoskronosmateriummetaphysical modelsnear death experiencespineal glandpropaganda critiqueshoshona
00:52:22
09 Aug 2012 Thu
Clif High / 20120809 – Clif High Audio #16
#unidentified flying objectstavistock instituteremote viewing2012baltic dry indexclimate changeconspiracy theoriescouncil for foreign relationscourtney browndecember 22expanding earthgolden agekali yugamayan calendarmayan long count calendarmind contrololympiapuget sound
00:53:36
2012 - July (2)
23 Jul 2012 Mon
Clif High / 20120723 – Clif High Audio #15
#time travelerstime perceptionshoshonaalternative physicsbig bang theorychronosconsciousness theoryeinsteinian conceptskaryosmateriummetaphysical modelspineal glandpropaganda critiqueremote viewingshadow groups
00:52:22
10 Jul 2012 Tue
Clif High / 20120710 – Clif High Audio #14
#strontiumsouth puget soundprecessional cyclesaluminumbariumbreatharianscalipawschemtrailsdark riftfukushima radiationfukushima reactor number fourmilky way coreocean acidificationoyster larvaepacific plate
00:41:17
2012 - June (1)
16 Jun 2012 Sat
Clif High / 20120616 – Clif High Audio #13
#woo woo worldwoojosydney opera housearab springasteroid impactcliff highcoastal floodingcourtney browndata gapsdow industrialed damefarsightglobal catastrophejune 2013remote viewingsolar events
00:38:21
2012 - May (1)
31 May 2012 Thu
Clif High / 20120531 – Clif High Audio #12
#yoga sciencewujowillpower trainingbardobardo conceptdojointernal linguistic dialoguekey energymeditation techniquesmudrasparasympathetic nervous systempatanjalipersistence of visionsensory entrainmentsympathetic nervous system
00:38:53
2012 - April (4)
20 Apr 2012 Fri
Clif High / 20120420 – Clif High Audio #11
#ufosthe sands of timestuxnetalien warsbitcoinconspiracy theoriescryptocurrencyeconomic collapsefukushimafukushima radiationiranisrael iran conflictjapanpalestinian populationsean david mortonsirius b clusterspace goat farts entity
00:53:34
16 Apr 2012 Mon
Clif High / 20120416 – Clif High Audio #10
#tribal thresholdtoroidal magnetic containmenttime dilation technologyadvanced vortex mathart bellben fulfordcliff highclosed time like loopsconspiracy theoriesdr andersonfukushima daiichifukushima nuclear disastermayan calendarnuclear disasterpseudosciencerodent coilstime dilation
00:28:53
08 Apr 2012 Sun
Clif High / 20120416 – Clif High Audio #9
#wujowoo woo artsjust in time systemaquaponicsbitcoincalorie economycivilization iconspiracy theoriescryptocurrencydigital asset organizationeconomic collapsefederal reservefinancial crisisfood securityfukushima
00:35:43
08 Apr 2012 Sun
Clif High / 20120416 – Clif High Audio #8
#woo woo artswashington state libraryuniversal rewardsalternative currenciescareer strategycooperative approachesdisintegrating dollarinfrastructure rebuildingjob versus worklocal economypersonal financeradio controlled planesself educationskill developmentswamp gas dangers
00:24:29
2012 - March (7)
31 Mar 2012 Sat
Clif High / 20120331 – Clif High Audio #7
#wujosiriusqueen of englandalex jonesaliensancient aliensconspiracy theoriesconversations with otomeledogon mythologygenetic engineeringjackalmedia censorshipmerovingian dynastynummopetroglyphsplanet bobpowers that beprometheus
00:50:10
29 Mar 2012 Thu
Clif High / 20120329 – Clif High Audio #6
#woo woo artsthrive globalspiritual awakeningcalorie based economycult of personalityeconomic transitionfascist rigidityhierarchical social modellife of unknowingpatriarchal structurespopepost truth erasocial hierarchy
00:35:16
24 Mar 2012 Sat
Clif High / 20120324 – Clif High Audio #5
#wujopsychopathic behaviorpseudoestrogenbrain developmentchemical bondingfemale unityforeskingender identityglobal conspiraciesgrand penis conspiracyhormonal engineeringilluminatimale circumcisionmasonsplastics
00:34:30
20 Mar 2012 Tue
Clif High / 20120320 – Clif High Audio #4
#wujoufo activitytime travelalien invasionbitcoincalorie economycernconspiracy theoriesfoster gamblegovernment collapseilluminatimagnetosphere blowbackmasonic symbolsnational death to americans actplanet xreptilian beingssands of timesean david mortonthrive movement
00:46:19
18 Mar 2012 Sun
Clif High / 20120318 – Clif High Audio #3
#zionist war of aggressionsummer solsticesolar flaresbankstersbitcoincliffs wujoclimate changecmeconspiracy theoriescoronal mass ejectioneconomic collapsefood safetyilluminatiiranian peopleradioactive contamination
00:31:52
16 Mar 2012 Fri
Clif High / 20120316 – Clif High Audio #2
#wushuwujo artswujoaikidoanamabardobodhiharmabruce leeconsciousness expansionenergy cultivationhui ming chingjudokey powerkung fumateriummeditation practicesmind controlni kungpatanjali sutrasphysical conditioningpranaqishaolin templetai chivaitavipassana
00:36:37
14 Mar 2012 Wed
Clif High / 20120314 – Clif High Audio #1
#wujowoo woo artssolar burstsalternative medicinebroccoli sproutscesiumfukushima disasterginsenghealth mitigationjet stream patternskefirnegative ion generatorspotassium iodineradiation exposuresolar activity
00:47:10