Transcribed 789 episodes - 581 hours
of The Truth Central - Dr. Jerome Corsi.
The Truth Central - Dr. Jerome Corsi
2026
2026 - January (8)
2025
2025 - December (18)
30 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State Meets the Deep Church: The Alliance That Changed Everything
#woke agendapope francispope benedict xvialliance for prosperityan almost insurmountable evilarchbishop carlo maria viganòcardinal theodore mccarrickcatholic church crisisdeep state conspiracydennis mcdonoughelection integritygods five stonesimmigration policyjoe bidenkamala harrismikenoah harariobama deep state
29 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Vatican Power Shift No One Explained
#wuhan pandemicthe two popestheodore mccarrickagenda 2030alliance for prosperityarchbishop viganocardinal zencatholic churchdeep state conspiracyglobalist agendajoe bidenmike cernovichobama administrationpope benedict xvipope francis
26 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Europe’s Dangerous Path Forward; The Convergence Is Here
#zohani mamdaniwestern civilizationvoter id lawsclydeburn investigationcorsi nationcultural maoismglobal warming hoaxinsurrection actisismueller investigationneo marxismobama coup détatradical islamrent controlsharia lawsomali welfare fraudukraine war
19 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Targeting of General Michael Flynn: Service, Sacrifice, and Retaliation
#sidney powellscott wiperrussian collusiondeep statedefense intelligence agencydepartment of justicedocumentary filmdonald trumpflynn the moviegeneral michael flynngovernment conspiracyjames clapperjerome corsijohn brennanmichael flynnobama administration
18 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Medical Cover-Up — Proven
#zapruder filmparkland hospitalmilitary industrial complex9 11bethesda naval hospitalciaclimate changecold war politicsconspiracy theoriescyril wechtdr jerome corsigovernment cover upsiraq warjames humesjfk assassinationlee harvey oswaldmedical forensics
17 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Supporting Veterans Beyond the Uniform
#yg storm nightstormveterantelemedicinecomveteran suicidecareer source south floridaderek stormsfaith based housinghomeless veteranshousing crisisjoshua maciasmiami barber institutenet zero constructionsection 8 vouchersveterans first projectveterans for america firstveterans for trump
16 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
From Soviet Rule to DHS Target: One Man’s Story
#wassonpresident zelenskypolitical prosecutionbishopcraigslist advertisementcustoms and border patrolcustoms enforcementdepartment of homeland securitydimitri kudrindonald trumpfourth amendment rightsfraud indictmentgods 5 stonesgovernment overreachimmigrant entrepreneurshipjerome corsimike novaplea deal
15 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Blood Rituals and the Destruction of the Nuclear Family with Cregg Lund
#silicon valley conspiracysilicon satansatanistsadrenochromeadrenochrome extractionaleister crowleycraig lundgene hackmanhollywood infiltrationjerome courseylee nelsonluciferian cultsluciferiansred scarf suicidessatanic ritual abuse
12 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Stalin’s NYT Propagandist and His Dark Secret Life
#woke culturewalter durantyukrainian faminealeister crowleyanne applebaumcarlo viganoclimate change denialcultural maoismgareth jonesgreat awakening trilogyjane sharonjohn holdrenjoseph stalinmalcolm muggeridgeneo marxismnew york timespope leo xiiisj taylorstalin regime
11 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
From JFK to Russian Collusion: The Deep State’s Long War
#victoria newlandvatican iithe final analysis2016 electionarchbishop viganobruce ohrchristopher steeleclinton campaigncoup détatdeep state conspiracydnc emailsdoug hornejfk assassinationmi6mueller investigationnew world orderrobert kaganseth richsteele dossier
10 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Susan Olsen Unfiltered with Dr Jerome Corsi
#susan olsenschool secularizationrobert f kennedy jraspergers syndromebrady bunchcatholic churchchildhood actingcovid 19 mandatesdeidonald trumpdr jerome corsihillary clintonhydroxychloroquineimmigration policyivermectinjudeo christian principlespolitical evolutionreligious convictions
09 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Europe Rejects Peace as Collapse Accelerates
#zelenskyukraine wartrump peace planarticle iibidencivilizational collapsecrimeadeidonald trumpdonbasseuropean declinehagsethislamophobianato strategyobamaputinsharia lawtim walz
08 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukraine War Is Over — Why NATO Is Finished and the EU Is Next
#zelenskyunited kingdomukraine war2026 electionact bluede industrializationeuropean economic collapsefrancegermanyglobalist conspiracyislamic takeovernato dissolutionnet zero policiesnuclear power plantspresident trumprussiaswiss americatim walztrump peace plan
05 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump’s Hemisphere Strategy vs. China’s Global Takeover
#us national securitytrump doctrinetony schaeferadam schiffbelt and road initiativechina belt and road initiativejoe bidenjohn corsijudicial reformlithiummonroe doctrine expansionms 13panama canalrare earth mineralssouth american resourcesstate department
04 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DOJ Sues Blue States — Voter Roll Fraud EXPOSED
#voter roll fraudukraine wartim walzact bluedecember 4th 2025democratic party corruptiondepartment of justicedonald trumpdr jerome corsigovernment legitimacyimmigration policymueller investigationobamareligious conflictsomalisswiss americataliban
03 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Horses Taken, Felony Charges Filed — But Was It All a Setup?
#sheriffs departmentproperty disputespalm beach county animal care and controlalternative medicineanimal crueltyanimal cruelty chargescivil proceduredr james maranakisdr jodi baerdue process rightsgovernment overreachholistic treatmentsland grablawfaremyopractics
02 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Democrats in Meltdown — Walz's Fraud and What They’re Hiding Now
#welfare fraudukraine wartsa pat downsdonald trumpeconomic collapseellen degeneresgavin newsomgender identitygeopoliticsimmigration policyjoe bidenjohn mearsheimermark kellyneo marxismpresidential electionsputinsomali immigrantstim walz
01 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Zelensky Cornered: The Peace Deal and Ukraine Corruption Blows Open
#victoria nulandukraine warswalwellact blueandrew wolfeantifablack lives matterconspiracy theoriesdonald trumpdonbasseconomic collapsegeorge soroshydroxychloroquineimmigration policyjerome corsijudge boazbergmueller investigationpolitical corruptionsandra beckstromsenator clyburn
2025 - November (18)
28 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Doctor Who Tried to Save JFK: The Truth He Never Spoke
#warren commissionuniversity of washingtonsecret servicebethesda naval hospitaldavid manticdr earl rosedr engeldr malcolm perryforensic evidencegovernment conspiracyjohn f kennedyjohn f kennedy assassinationlee harvey oswaldmilitary industrial complexmk ultraparkland hospital
26 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dark Rituals & the Tech Elite — Exposed
#silicon valley elitesilicon satansatanic ritualsandrew tatecraig lunddonald trumpepstein filesfrench president macrongreat resetkenneth owenslarry ellisonluciferian conspiracylucifer warsnorman vincent pealeoprah winfreyp diddy
25 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Obama’s Deep State Took Over the Catholic Church
#theodore mccarrickpope francisoperation condor2020 electionalliance for prosperitycarlo maria viganòcatholic churchchild traffickingdeep statedennis mcdonoughjd vancejerome corsijoe bidenjohn f kellyjorge bergogliojuan orlando hernandezmike mccormick
24 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pokrovsk Falls — The Moment Ukraine Lost the War
#vladimir putinukraine wartrump administrationbenjamin netanyahuconspiracy theoriesdonbass regiondr jerome courseyeconomic policygaza conflicthamasnew world orderpokrovskpresident trumppresident zelenskyswiss americatomahawk missilestranshumanism
21 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Plagiarism, Antisemitism & DEI: Harvard’s Crisis Revealed
#the gay affairsmith mundt actplagiarism allegationsacademic integrityaffirmative actionart lafferblack faces black interestscarol swaincbdcclaudine gaycritical race theorydiversity equity inclusionharvard universitykamala harrisoperation mockingbird
20 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#social control mechanismsreligious educationrachel carsonbrian sussmancarbon taxcbsclimate change skepticismclimate cultdan ratherenvironmental movementfrederick engelsglobal warming scamgreen new dealjerome corsimarxist ideologymilgram experimentpaul ehrlich
19 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Clintons Cornered? Subpoenas, Silence & Epstein Fallout
#western civilizationswiss americaradical islambbcciaclintonsdonald trumpeconomic collapseepstein documentsjames watsonjohn solomonmichael snydermossadpam bondiphyllis schlaflypost feminism
18 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Globalists Preparing for 2026 Chaos? New Evidence Revealed
#zoran mamdaniwalking liberty half dollarsvladimir zelenskychristopher wrayconspiracy theoriescultural marxismdonald trumpeconomic collapsegateway punditgovernment censorshipjeffrey epsteinjulian assangekatie wilsonlarry summersliberty dailymueller investigationpolitical corruptionroger stoneswiss americathe economist
17 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
20 Million Missing: Gen Z Collapse; The Democrats' Latest Epstein Hoax Exposed
#virginia jaffreeneo marxismmueller investigationabc newsabortion impactdemocratic socialists of americadivorce proceedingsdonald trumpdonbasdr jerome corsifrankfurt schoolgeneration xjeffrey epsteinjillian maxwelljulian assangemedia censorship
13 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the #JFK Assassination The Medical Cover Up
#the final analysistexas school book depositoryroyal otisal chincbethesda autopsybulky beaverciaconspiracy theoriesdavid manticdr boswelldr crenshawdr humesdr jerome corsifbi 302 reportsgovernment cover upsjfk assassinationjfk x rayslee harvey oswaldparkland hospital
12 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Antifa Chaos at TPUSA Event; Clinton Foundation Trouble; Ukraine Corruption Exposed
#turning point usatimor mindichpresident zelenskyantifaantifa violencearticle iicharlie kirkclinton foundationdonald trumped martinelection integrityforeign policygovernment shutdownhillary clintonhuma abedininsurrection actjoan courseypartners in crimepolitical corruption
11 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Millions Want a New California | Can Article IV Save America?
#voter fraudusaidtommy gongagenda 21 radioandrew yangbarack obamacalifornia politicsconstitutional authorityelection integritygavin newsominsurrection actjulie sunew california statepaul prestonreynolds v simssharia lawsheriff arpaio
10 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Shutdown Deal Revealed | Trump Pardons Shake Deep State
#zohran mamdaniwalking liberty half dollarvoter frauddemocratic partyeconomic crisiselection integrityforeign policygold pricesgovernment shutdownjerome corsijohn eastmanpelosireligious faithrudy giulianirussian missile attackschumertodd blanchetrump pardons
07 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
NYC Goes Socialist: Bezmenov’s Warning and What Zohran Mamdani’s Win Really Means
#zohran mamdaniyuri bezmenovvoter id lawscommunist subversioncourseynationdemocratic partydonald trumpdonbass regioneconomic declineelection integrityeugene v debsgreen energy policiesjerome corsikgbmarxist ideologysenate filibuster
06 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump’s New Executive Order on Election Integrity | DOJ Corruption Exposed
#zohran mamdanivoter id lawstulsi gabbard2 chronicles 7 14act bluealexandria ocasio cortezandrew yangbarack obamaconspiracy theoriesdemocratic partydonald trumpelection integritygeorge sorosglobal economic declinekamala harrismail in votingproposition 50swiss america
05 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Socialist Wins NYC: National Impact or Local Collapse?
#virginiaswiss americasatmar hasidicabigail spanbergerdonald trumpelection integrityfinancial independenceforeign relationsimmigration policyjay jonesjerome courseymandamimickey sherrillnew jerseynew york citypublic healthrobert kennedy jr
04 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Soros Funds NYC Socialist Candidate + Comey Hoax Note Revealed
#zohran mamdanivice president cheneyswiss americabarack obamacaredemocratic party radicalizationdick cheneyelection fraudgeorge sorosgold silver investmentshillary clintonjames comeyms 13russia ukraine warstephen miller
03 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
$1.4B in Illegal Benefits? SNAP Crackdown Begins
#zlenco protocoltimothy clyburnsnap benefitsarctic frost scandalbarack obamabill gatesbrooke rollinscbsconspiracy theoriesdonald trumpelection integrityhealthcare reformhydroxychloroquineimmigration policyjack smithjudge bosebergmedia censorshipmueller investigation
2025 - October (22)
31 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
3 Bullets, Multiple Shooters: The Real JFK Story
#warren commissiontexas school book depositorypearl harbor9 11al kohnbethesdaciaconspiracy theoriesdaltex buildingdavid manticdr clarkdr crenshawforensic analysisgovernment deceptiongrassy knolljoan corsijohn f kennedy assassinationlee harvey oswaldparkland hospital
30 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
China Deal, Jack Smith’s Hit List & America’s New Nuclear Era
#xi jinpingus china relationssteele dossierarctic frost probebill gatescarter pageclimate changecultural marxismdominion voting systemsdonald trumpdonbasselection integrityfentanylgods five stoneshillary clintonjack smithjerome courcyking charlesmaidan revolutionmedia censorshipnuclear weapons testingoperation crossfire hurricaneprince andrewrussia ukraine warsenator grassleysnap benefits
29 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Election Integrity Under the Microscope | Major Investigation Update
#voter id lawstulsi gabbardpeter ticton2026 midtermsandrew paquettearticle ii powersballot harvestingdominion voting machinesdonald trumpelection integrityforeign interferencegerrymanderinggods five stonesinsurrection actjoan courcymail in votingobama coup détat
28 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
NYC Radical Shift + Global Power Chessboard
#zoran mamdanirussia ukraine warjoe bidenai chatbotsai safety concernsalexandria ocasio cortezbill gatesbricsclimate change skepticismcourseynationdeidemocratic party declineedward kennedy instituteelection reformelectric vehiclesgods five stoneshamasiranian revolutionjerome coursey
27 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Democrats’ Dirty Money, Germany’s Ruin & Trump’s Global Showdown with Xi
#zelenskyxi jinpingviktor orbanabraham accordsantifachinacoursey nationdemocratic partydomestic politicsdonald trumpeconomic policyeuropean unionglobal tradegods five stoneshamasimmigration policyinternational conflictjoan courcynuclear warfareportlandpresident mondaleskyfall missiletd bankukraine war
24 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arctic Frost Exposed | Trump’s Control Tightens & Deep State Faces the Heat
#xi jinpingtrade negotiationssenator grassleychristopher wrayclimate depotdonald trumpenergy policyfaagovernment shutdowniceinternational relationsjack smithjeffrey garlandlegal prosecutionsletitia jamesoctober surprisesronald reagan
23 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Can Force an Endgame in the Ukraine-Russia War | Corsi Nation Breakdown
#zelenskyvladimir putinus national debtabraham accordsdeep statedonald trumpdonbasseconomic debtgold investmentjerome corsimedvedevnatonuclear deterrencerussia gatetomahawk missilesukraine russia war
22 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Shakes Up Global Power: Putin Summit Canceled, Vance in Gaza, Guard to Portland?
#volodymyr zelenskyvladimir putinvenezuela drug tradeantifabenjamin netanyahucivil unrestdominion voting machinesdonald trumpelection integritygold pricegovernment shutdowninsurrection actisrael gaza conflictjd vancejohn brennannatorussia ukraine wartomahawk missiles
21 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#x raysvietnam warthe assassination of john f kennedy the final analysisciaconspiracy theoriesdealey plazadeep statedr malcolm perryevalia glangesford motor companygeorge whitaker srjerome corsijfk assassinationjohn f kennedylee harvey oswaldnational archivesnick principerobert harrison
20 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The 'No Kings' Protest Fizzles, Trump Denies Zelenskyy and Xi Cleans House
#zelenskyyxi jinpingwarren buffettabraham accordsarabella networkchina politicsdonald trumpdonbaseconomic debtford foundationforeign policygates foundationgeneral kelloggisrael hamas warjerome courcymaidan rebellionnatono kings protestsrockefellerscott hortonsoros networksteve witkoffswiss americatides foundationukrainevladimir putin
17 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
15 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
14 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
10 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
09 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
08 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
07 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
06 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
03 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
02 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
02 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
01 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
2025 - September (20)
30 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
29 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
26 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
25 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
23 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
22 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
19 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
18 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
17 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
16 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
15 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
12 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
11 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
10 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
09 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
08 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
05 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
04 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
03 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
02 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
2025 - August (21)
29 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
28 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
27 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
26 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
25 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
22 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
21 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
20 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
19 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
18 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
15 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
14 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
13 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
12 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
11 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
08 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
07 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
06 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
05 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
04 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
01 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
2025 - July (22)
31 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Walter Duranty: Stalin’s PR Agent for the New York Times
#walter durantyukrainian faminetranshumanismaleister crowleyanarchybishop carlo viganoclimate change denialcritical theorycultural maoismgareth jonesjoseph stalinkulaksmalcolm muggeridgeneo marxismnew york timespope leo xiiisaint michaelsiberiatransgender rights
30 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Deep Does the Act Blue Financial Fraud Scandal Go?
#weaponized earthquakesstephord jonessean tayloract blueact blue scandalamerican thinkerbiden administrationburismahunter bidenjerome courcymark finchemmortgage fraudnunes reportobama administrationpolitical corruptionregina wallace jonesrussian interference
29 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Whistleblower: Act Blue Engaged in Billion-Dollar Fraud
#vladimir putinsean taylorpolitical corruptionact blueconspiracy theoriesdonald trumpeconomic collapseelectric vehicleselizabeth warrenepstein affairfederal reservegateway punditglobalismjerome powellkathleen johnsonmoney laundering
28 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Mainstream Media in Denial Over Gabbard’s Russiagate Findings
#tulsi gabbardswiss americarussian collusionandrew paquettecarter pagechristopher steelecourseynationdonald trumpelection integrityfbi indictmentsforeign policygold investmentsjames clapperjerome corsijohn brennanlindsey grahamms 13
25 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#warren reportthe final analysistexas school book depositoryboswellcia operationsconspiracy theoriesdearborn michigandeep statedouglas weldonford motor companygeorge whitaker srjames humesjerome corsijfk assassinationlee harvey oswaldmalcolm perrynational archivesrobert harrisonroy schaefer
24 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#solar radiation managementscientific integrityreligious awakeningbrian susmancarbon taxesclimate change denialclimate cultclimategatedan rathereco tyrannyenvironmental movementfrederick engelsgreen new dealjerome corsimarxist ideologypaul ehrlichrachel carson
23 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside Hollywood’s Whitewashing of the Catholic Church Coup Against Pope Benedict
#wuhan pandemic originswuhan pandemicthe two popesagenda 2030an almost insurmountable evilarchbishop carlo maria viganòcatholic church politicscritical race theorydeep state conspiracyhigher ground productionsi accusejoe biden impeachmentjuan orlando hernandezmike mccormickpope francis legitimacypresidential medal of freedomtheodore mccarrick
22 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did the Deep State and the Deep Church Accommodate Drug and Child Trafficking Out of Honduras?
#vice president cheneysinaloa cartelpope francisalliance for prosperitycardinal theodore mccarrickcarlo maria viganòcatholic churchcatholic springchild sex traffickingdeep statedennis mcdonoughdr jerome corsidrug traffickingel chapoimmigration policyimpeachmentjoe bidenjuan orlando hernandez
21 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside Tulsi Gabbard’s Obama Russiagate Bombshell
#zelenskyxrptulsi gabbardbarack obamaconspiracy theoriescryptocurrencydonald trumpdr jerome corsieconomic collapsegeneral kellogginternational relationsjames clapperjohn brennanjulian assangeperkins coiepolitical coup allegationsseth richsteele dossierswift
18 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Blood Rituals and the Destruction of the Nuclear Family with Cregg Lund
#silicon valley corruptionsilicon satansatanic panicadrenochromechild exploitationconspiracy theoriescourseinationcomcraig lundjoan corsilee nelsonluciferian eliteluciferian ritualsmalcolmraj
17 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Client List: MAGA Wants it Released, Trump Doubles Down
#trump administration policyreligious extremismprince andrewact bluebarack obamabill clintondemocratic party conspiracydonald trumpdr jerome courseyeconomic collapseelon muskfederal reserveghislaine maxwelljeffrey epsteinjeffrey epstein casejerome powellken paxton
16 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why CopiaPort E in Chile is a National Security Priority with LTC (Ret) Tony Shaffer
#tulsi gabbardresource controlrare earth mineralsable dangeradam schiffarticle iibelt and road initiativechina belt and roadcopiaport eforeign interferencehollywoodjudicial reformlithiummonroe doctrinems 13national securitypope francis
15 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#sidney powellscott wiperrussiagatedeep statedirector of defense intelligence agencydonald trumpfbi indictmentflynn the movieforeign agent chargesgeneral michael flynngovernment overreachjerome corsimichael flynnmueller investigationmueller reportnational security advisorplea deal
14 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Files: Is it a Matter of Time Before the Client List is Released?
#woke agendawar on terrorvladimir putinbelt and road initiativebricsciadonald trumpdr jerome corsieconomic collapseepstein affairglobal geopoliticsgovernment reformking charlesmossadpam bondisecret servicesergei lavrovswiss america
11 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Files: Is King Charles Involved?
#ukraine wartrump administrationprince andrewact blue scandalalan dershowitzbarack obamabill clintonbritish royaltyepstein filesgold priceshillary clintonjeffrey epsteinjerome courseyking charles iiimichael kelloggoperation crossfire hurricaneoperation mockingbird
10 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Files: The Truth Behind the Cover-Up
#voter fraudswiss americaprince andrew25th amendmentandrew paquettebarack obamabill clintonbricschristopher wrayconspiracy theoriescourseynationdan bonginodonald trumpelection integrityepstein caseforeign interferencehillary clintonjames comeyjerome corsijohn brennankash patelkeith kelloggking charlespam bondipeter titkin
09 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Files: What Are they Hiding and Why?
#veterans first foundationpam bondilegal investigationsact bluealternative medicinebill clintonbill gatesbrian murphyconspiracy theoriesdan bonginodonald trumpgeopolitical threatsgods five stonesgovernment cover upjames comeyjeffrey epsteinjohn brennanjoshua maciaskash patelkim erickson
08 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Epstein Files: Will We Ever Get the Truth?
#zorah mamdanivolodymyr zelenskyveterans supportamerica first projectandriy yermakbill clintoncash patelconspiracy theoriesdan bonginodeep stateeconomic crisiselon muskepstein casehillary clintonjeffrey epsteinjerome courseypam bondiukraine warveterans first
07 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Fundamental Changes in Middle East Relations Coming
#palestinian authorityone big beautiful billnatoact bluebenjamin netanyahuconspiracy theoriescryptocurrency policydan bonginodeep statedonald trumpelection integritygods five stonesiran nuclear programjeffrey epsteinjoe bidenkash patelmiddle east peace
03 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why CopiaPort E in Chile is Extremely Important and Should Not Go to China
#zbigniew brzezinskitrump administrationsouth american portsbelt and road initiativebiden familycape hornchina expansionchiricahua apache nationcopia port ecoppergeopoliticshacienda castillajimmy carterklaus schwablithiummitch mcconnellpanama canalresource control
02 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Senate Passes Big Beautiful Bill; RFK, Jr. Drops Bombshell on Tucker
#xrpvoter id lawsrobert f kennedy jract blueanthony faucicdccryptocurrency adoptioneconomic collapseelection integrityforeign policygods five stonesgreen energy subsidieshealthcare fraudhepatitis b vaccineshillary clintonlisa murkowski
01 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Big, Beautiful Bill Battle
#zelenskyxrpukrainecloward piven strategydonald trumpelon muskfederal reservefiat currencyforeign policygazagold standardiranjerome courseymoodysnational debtnatoneo marxismspacexswift systemtesla
2025 - June (21)
30 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Iran Lost its War with Israel: The True Story
#tucker carlsonreligious extremismmiddle east conflictabraham accordsalex jonesayatollah khameneibelt and road initiativebenjamin netanyahuconspiracy theoriesdonald trumpeconomic policyelectoral integrityfederal reservegods five stoneshugo carvajal berriosjerome corsi
27 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Propping Up of Zohran Mamdani as the Dems Double Down on Socialism
#zohran mamdanivictor davis hansonswiss america2020 election2024 electionaocbig techcourseynationdeep statedemocratic partydr jerome corsielection integrityfinancial crisisforeign policygods five stonesms 13myvital c
26 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Report: Damage Done to Iran’s Nuclear Facilities “Massive”
#zohran mamdanius debtpolitical corruptionactbluedebbie wasserman schultzdonald trumpelection fraudesfahanfinancial crisisfordogary bernsteinhugo carvajalimmigration policyinstitute for science and international securityiran nuclear programjason jonesjerome corsinatans
25 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left Goes Insane Over trump Iran Policy; NYC Dens Choose Socialist to Run for Mayor
#zoran mamdanius mayoral electionsisrael iran conflictabraham accordsal greenandrew cuomoayatollah khameneibricschina geopoliticscopia port ecurtis sliwadefense intelligence agencydonald trumperic adamshamashezbollahhousing crisishres 537immigration policy
24 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Iran-Israel Ceasefire: What Happens Next?
#trump administrationsupreme court rulingnatoabraham accordsb 2 bomberscourseynationdonald trumpeconomic crisisfordo plantgold and silverimmigration deportationisrael iran warjerome corsijoe bidenjohn kerrymiddle east policy
23 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Seduction and Grooming The Darkness Under Silicon Valley’s Cloak - Part 5
#silicon valleysilicon satansexual revolutionadrenochromeadrenochrome industryaleister crowleybiden administrationchild sexual exploitationconspiracy theoriescraig lunddr jerome courcyherbert marcusejeffrey epsteinjfk assassinationp diddypost hill pressred scarfing
20 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran: What Will Trump Do?
#zelenskyus foreign policytucker carlsonclinton familydonald trumpeconomic collapsefordowiranisraelisrael iran warjerome corsijimmy carterkhomeininuclear proliferationregime changesteve bannonswiss americatel aviv
19 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Tucker vs. Cruz: Who Was Right About Dealing with Iran?
#tucker carlsonted cruzrussiagate9 11abortion rightsayatollah khomeiniconspiracy theoriesdonald trumpeconomic collapsefederal reserveiranisraelisrael iran conflictjerome corsijfk assassinationnuclear proliferationregime changeroe v wade
18 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The CCP Election Interference Scheme’s Deep State Connection
#voter id requirementstranshumanismtony blinken2020 election fraud25th amendmentayatollah khameneibill burnschina influence operationscisacritical race theorygold standard economicshunter bideniran israel conflictjanuary 6thjanuary 6th insurrectionjerome corsikash patelnancy pelositom grassley
17 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A CCP Plan to Create Fake Mail-In Ballots Exposed?
#ukraineswiss americamarkham2020 election9 11 attackschristopher wraycommunist party of chinaconspiracy theoriesdonald trumpelection integrityfinancial crisisforeign interferenceg7 meetingglobalismgold pricesiranjeffrey epsteinjerome corsijfk assassination
16 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran-Israel War Intensifies. Is There an End in Sight?
#zelenskyvance boltonukraine conflictactblueatomic iranayatollah khomeinidemocratic partyeconomic crisisimmigration policyisrael iran warjerome corsimelissa hortmannational debtswiss americatransgenderism
13 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Secret Rituals: The Darkness Underneath the Silcom Valley Elite, Part 4
#silicon valley conspiracysilicon satansatanic rituals9 11 conspiracyanti globalist manifestobill clintonconspiracy theoriescraig lundhasatanhsbc money launderingjeffrey epsteinjerome corsijfk assassinationluciferian elitenew world orderp diddyreligious conflict
12 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Money and Power Behind the Riots: This is No Grass-Roots Movement
#transhumanismtd bankpolitical insurrectionabc newsacluact bluealexandria ocasio cortezantifacnndr dronejerome corsilos angeles riotsmaxine watersmedia censorshipnew world orderngo funding
11 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Silicon Satan Author Cregg Lund Reveals the Hidden Darkness Behind the Silicon Valley Elite
#silicon satanrobin williamsreligious extremismandrew tateartificial intelligencebarack obamaconspiracy theoriescorsinationdonald trumpemmanuel macrongaza vision videolarry ellisonluciferian elitemedia censorshipnew age movementsnorman vincent pealep diddyred scarfing
10 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The LA Riots: Insurrection Theater and the Left’s Downward Spiral
#social unrestpolitical insurrectionpatriot act2026 electionabc newsactbluealexandria ocasio cortezauthoritarianismcultural identitydemocratic partydonald trumpjerome corsilos angeles riotsmaxine watersmedia censorshipms 13
09 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Who Develops CopePort E Will Dominate Maritime Trade in the Western Hemisphere
#ukraine war crimestodd callendersouth american portsagenda 2030belt road initiativecentral bank digital currencychina influence operationscopia port ecotswold groupelizabeth warreneric swalwellhacienda castillalindsey grahammike pompeominsk accordsmitch mcconnellpanama canalreplacement theorysocial credit scores
06 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump v. Musk: Discord or Theatrics?
#zelenskyxrpusaidbill gatesblack lives matterconspiracy theoriesdeep statedonald trumpdr jerome corsielon muskglobalismgovernment corruptionjoe bidenlindsey grahammike pompeonew world orderpolitical feudssocial securityukraine war
05 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Spiraling toward world war III: The Economic Factor
#xrpworld war iiivolodymyr zelenskyallianz tradecrimea bridgecryptocurrencydonald trumpeconomic collapseexecutive powerfederal reservegold standardiran nuclear programjerome corsiparis riotssocial securityswift systemukraine warvladimir putinvolkswagen
04 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Debt, Trade Battles and the Future of the U.S. Economy
#us economyukraineswiss americabasel iiicopiapó portcrimean bridgedonald trumpfederal reserveglobal conflictgold investmentimmigration policyjerome corsijerome powellmodern monetary theorymonetary reformmyvitalcscott bessent
03 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are We Closer to a Russia-Ukraine Ceasefire or WWIII?
#world war iiisteele dossierrussia ukraine warcorsi nationcrimeagates institutegeneral flynnglobal economic crisisgreat replacement theoryjerome corsijulian assangekerch bridgemueller investigationnatonato expansionpresident zelensky
02 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is Zelenskyy Trying to Start World War III?
#world war iiiswiss americasharia lawciadr jerome corsieconomic crisisgeorge sorosglobalismimmigration policymoodysmount etnanuclear weaponspresident trumppresident zelenskyysanctuary cities
2025 - May (21)
30 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Malcom Perry, The Man Who Tried to Save JFK: What Did He See? with Dr. Juliette Engel
#texas school book depositoryparkland hospitalmkultraaudrey bellbethesda naval hospitalciaconspiracy theoriesdavid manticdr juliette engeldr malcolm perrydr mcclellandforensic evidencegovernment cover upjohn f kennedyjohn f kennedy assassinationlee harvey oswaldmedical testimony
29 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Debt Crisis: Credit Default Swaps are Happening Again
#td banksinaloa cartelproject veritasburismacredit default swapscultural maoismcultural marxismdavid hoggdepartment of government efficiencyeconomic collapseelon muskgeopolitical conflicthunter bidenimmigration policyjerome corsikash patelnational debtneo marxismpolitical corruptionprecious metals
28 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump vs. Harvard Heats Up
#zelenskyukraine wartrump administrationdan bonginofederal funding cutsglobal economic collapseharvard universityhillary clintonisrael hamas warjerome corsimedia biasprovokeputinscott hortonswiss americatodd callender
27 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DOJ Cracks Down on Child S*x Exploitation
#zelenskyxrpukraine warbelt and road initiativechild sex traffickingcolorado state legislaturecraig lunddemocratic party conspiracyeconomic declinefrankfurt schoolhamasisrael hamas warjerome corsikash patelmichael rosenetanyahuoperation restored justicepam bondiswift system
23 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvatican iithe final analysis2016 electionarchbishop viganobruce ohrchristopher steelecoup détatdeep statefisafisa surveillancejohn f kennedyjohn mccainmichael isikoffnew world orderrussia collusionseth richsteele dossier
22 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#x raysvietnam warthe final analysis9 11bethesda doctorsciaconspiracy theoriesdavid osbornedeep stateford motor companygeorge whitaker srhistorical revisionismhr freemanivalia glangesjerome corsijfk assassinationjohn f kennedylee harvey oswaldlone gunman theorymilitary industrial complexnational archivesrobert harrisonstavis ellistexas school book depository
21 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About Volodymyr Zelenskyy from Fellow Ukrainian Entertainer Mike Nova
#yuri kostiukvoting fraud detection algorithmsvolodymyr zelenskyycocaine usedepartment of homeland securitydmitry kudrundonald trumpdrug abuse allegationsmike novapeace negotiationsruslan honcharenkotelegram messagestraumatic brain injuryukraine warus foreign aid
20 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The DOJ Takes on California’s ‘Sanctuary State’ Policy
#voter fraudus attorney essaleysupreme court justice robertsalexandria ocasio cortezbarack obamaconspiracy theoriescraig lundeconomic crisisgeorge sorosimmigration enforcementjames comeyjerome corsijoe bidenjudicial reformmark eliasmike mccormickperkins coiesanctuary citiessatanism
19 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Should John Brennan be Charged with Treason?
#swiss americasteele dossierrussia ukraine warandrew mccabeaocconspiracy theoriesdan bonginodemocratic partyeconomic crisisfbi investigationjake tapperjames comeyjoe bidenjohn brennankash patelmaxine watersmodern monetary theorypolitical corruptionroger stone
16 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi Talks with Susan Olsen: Cancelled from a Brady Bunch Revival, Growing up in Hollywood
#susan olsenrobert f kennedy jrreligious educationabortion rightsanti vaccine movementbrady bunchbrandon strakacardinal mccarrickchildhood actingchild protective servicescovid 19cultural conservatismdeidonald trumphydroxychloroquineivermectinjudeo christian principlespolitical censorship
15 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukrainian-American Wrongfully Persecuted by the Biden DHS: Dmitry Kudryn Tells His Story
#zelenskywitch huntweaponized justicecriminal prosecutiondepartment of homeland securitydimitri kudrindonald trumpgods5stonescomimmigration enforcementjerome corsimike novaneo marxistpolitical corruptionrussia ukraine conflictty bishopvladimir putin
14 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Luciferians’ Obsession with Hawaiian Culture
#transhumanismsilicon satansatanic cultsadrenochromeancient hawaiian culturecocainecraig lunddrug useecstasyjeffrey epsteinjerome corsikalua pig ritualking kamehamehap diddypedophilia
13 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The New Pope and the Direction of the Catholic Church with Mike McCormick
#vatican politicsvatican banksinaloa cartelarchbishop carlo maria viganòcardinal theodore mccarrickcatholic churchchinese communist partydeep state conspiracydennis mcdonoughglobalismimmigration policyjerome corsijoe bidenjuan orlando hernandezmike mccormickpope francispope leo xiv
12 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Was Jeffrey Epstein An Intelligence Asset? Why Did Powerful Democrats Meet With and Enable Him?
#william burnsvoter fraud allegationsvladimir zelenskybasel iiibricscatherine rumerdonald trumpeconomic collapsegold standardjeffrey epsteinjeffrey epstein conspiracyjerome corsilou provostnancy pelosiphilip escaravagepope francisukraine russia warus china trade deal
09 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Who is Pope Leo XIV? Plus: Two Big Wars Poised to Escalate
#zelenskyukraine conflicttom tillisbelt and road initiativecasey meanscatholic churcheconomic collapseed martingazahamasisrael hamas warjanuary 6th insurrectionjeanine pirrojerome corsijoe bidenmacronneo marxismpope leo xivrobert f kennedy jrrobert francis prevost
08 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Turncoat Tillis Blocks Ed Martin’s Nomination; Kash Patel Schools Leftist Pol on Accountability
#veterans firsttom tillisprince andrewconspiracy theoriesdavid horowitzdemocratic partyeconomic collapseed martinhenry kissingerhomeless veteranshunter bidenjanuary 6th insurrectionjason goodmanjeffrey epsteinjerome corsikash patelmedia censorshipmichelle obama
07 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Plagiarism in Academia: the Decline of Academic Integrity and Leadership with Dr. Carol Swain
#trump executive orderthe gay affairplagiarismacademic integrityart lafferblack faces black interestscarol swainclaudine gaycopyright lawsuitcritical race theorydei programsharvard universityidentity politicskamala harrismeritocracynational science foundation
06 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Wants Gold Star Mom and Political Prisoner Released from a Colorado Prison
#zelenskyuniversity of washingtonuniversity indoctrinationalina habbaantifaconspiracy theoriesdan bonginodonald trumpelection fraudgeorge sorosharvard universityisrael hamas warjerome corsijoe bidenkash patellawfarenatonord stream pipelinetina petersukraine conflict
05 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
New Evidence of Voter Roll Integrity Issues in Wisconsin: Plus, Trump’s ‘Meet the Press’ Convo
#voter fraud allegationsvolodymyr zelenskytulsi gabbardarchbishop viganocatholic church politicsdonald trumpeconomic collapsegold pricesisrael gaza conflictjerome corsijoe bidenkamala harriskash patelkristen welkermartin armstrongmeet the pressms 13nuclear war theorypope francispresidential interviews
02 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is Trump Getting Sick and Tired of Zelenskyy’s Antics? Plus: Trump Defunds NPR, PBS
#voter integrityvolodymyr zelenskyyukraine warbarack obamadhseconomic collapsefbigoogleharvard universityhigher educationklaus schwabkolomowskimedia censorshipnprpbspinochekpope francisswiss america
01 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Zelenskyy Finally Signs Rare Earths Deal with the US: What’s Next with Ceasefire Talks?
#voter fraudviktor pinchukvictoria nulandalina habbacarbon 60deep statedonald trumpdr jerome corsied martinfrench president macrongeorge sorosglobalismhillary clintonnew world orderpope francispresident zelenskyysecond trump administrationswiss americaukraine war
2025 - April (22)
30 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Finally: A Task Force on Election Integrity Will Be Assembled
#ukrainetrade policyreligious controversyadam schiffalina habbaandrew paquetteanthony moranarchbishop viganoconspiracy theoriesdisease xed martinelection integrityfinancial marketsforeign interferencejerome corsikash patelkristi noemms 13mueller investigationpope francis
29 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Blood Rituals and the Destruction of the Nuclear Family with Cregg Lund
#sloansilicon valleysilicon satanadrenochromeadrenochrome extractionanniecraig lundgene hackmanhollywood infiltrationjerome corsiluciferian cultsluciferiansnuclear familyrajred scarfsatanists
28 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State's and Hollywood's Evil Intentions Behind the Conclave Movie
#wuhan plandemicworld economic forumvatican conspiracyarchbishop viganoconclave moviedennis mcdonoughdr jerome corsijaccusejoe bidenjohn brennanjorge bergogliolgbtq+ rightsnew world orderobama deep statepope benedictpope francistheodore mccarricktwo popestwo popes movie
25 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Hidden Evil Surrounding the Dark Alliance Between the Deep State and Deep Church
#wuhan pandemic originstheodore mccarrickpope francisalliance for prosperityan almost insurmountable evilcatholic church corruptiondeep statedeep state conspiracydennis mcdonoughimmigration policyjerome corsijohn f kellyjorge bergogliojuan orlando hernandezlgbt agendamike mccormickmorality laundering
24 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Tulsi Gabbard Refers Two Who Leaked Classified Info to WaPo, NYT for Prosecution
#vladimir zelenskytulsi gabbardtrump administrationburismadojo leadershipforeign policyhillary clintonjerome corsijoe podestajohn robertsjudicial reformkash patelmatt drudgems 13pam bondipope francisreligious freedomsocial security
23 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Again: Where Are the Investigations as Lawfare Against Trump Elevates?
#world economic forumtesla showroomssoros judgesarticle ii powerschief justice robertsconspiracy theoriesdoge initiativeelection integrityelon muskfederal government reformglobal economic crisisjerome corsijudge boesburgjudicial independencekash patelklaus schwabobamacarepam bondiron johnson
22 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why CopiaPort E in Chile is a National Security Priority with LTC (Ret) Tony Shaffer
#trump administrationtony shafferpanama canalable dangeradam schiffbelt and road initiativechina expansioncopiaport egeopoliticsgeorge sorosjerry corsijoe bidenjudicial reformmonroe doctrinems 13national security
21 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why CopiaPort E in Chile is Extremely Important and Should Not Go to China
#us foreign policytrump administrationsouth american geopoliticsbelt and road initiativechile atacamachinachina belt and road initiativechiricahua apache nationcopia port eglobalist conspiracy theoriesgreenlandhacienda castillahenry kissingerklaus schwablithiumpanama canalresource nationalism
18 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dem Senator Sips Cocktails with Gang-Affiliated Deported Illegal Immigrant
#religious fundamentalismpolitical corruptionpaul g sawyersaileen boasbergbarack obamachris van hollenclaudine gayconspiracy theoriesdonald trumpeconomic collapseeuropean uniongilmar obrego garciaharvard universityimmigration crisisjerome corsijerome powelljoe bidenluigi mangione
17 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Seduction and Grooming: The Darkness Under Silicon Valley’s Cloak - Part 5
#wheres wallysilicon valleysilicon satanadrenochromearchbishop mccarrickbiden administrationchild safetyconspiracy theoriescorsi nationcraig lundherbert marcusejerome corsijfk assassinationmike mccormickpost hill presssatanic panicsexual revolution
16 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump’s Election Integrity Investigation is Ongoing: What Happens Next
#tulsi gabbardtina peterssalt typhoonarticle iichristine noemchristopher krebsdonald trumpelection integrityexecutive powerfinancial crisisforeign interferencejerome corsijohn radcliffeletitia jamesmichael flynnnational securitypam bondi
15 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Unraveling the Media Narrative on Trump’s Deportations
#xrpusaidtucker carlsonbelt road initiativebozabardonald trumpeconomic policyfederal reserveforeign policyharvard universityjerome corsimarco rubiomarxism critiquemedia criticismpete moroccostephen millertrump administration
14 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The US and CCP Chess Game over Tariffs, Western Hemisphere Ports
#volodymyr zelenskyvladimir putinviktor pinchukchina belt and roadclaudine gaycopia port edonald trumpgeorge sorosgina raimondoglobal economic crashincome tax eliminationkash patelmark eliasoleg deripaskapam bondisemiconductor tariffssteele dossiertodd callenderukraine war
11 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Gabbard: Electronic Voting Systems Vulnerable to Hackers and Manipulation
#xrpvoting system fraudviktor pinchukbabylon beechris krebsdemocratic party criticismdominion voting systemsdonald trumpelection integrityihor kolomoiskyjerome corsioperation election integritypam bondipolitical conspiracy theoriestrump foreign policytulsi gabbard
10 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why is Pam Bondi Still Dragging Her Feet On Corruption Investigations?
#zelenskyvoter fraud allegationstulsi gabbardadam schiffattorney general bondicritical race theorydemocratic party corruptiondisease xeconomic collapseed martinelizabeth warrenforeign policy critiquejames clapperjerome corsijohn brennanpam bondiswiss america
09 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Wisconsin Supreme Court Election Warrants a DOJ Criminal Investigation
#wisconsin supreme courtvoter fraudsteele dossieractblueadam schiffclinton foundationconspiracy theoriesdrone corsielection integrityepstein listforeign policyhillary clintonjudge crawfordjudicial reformkash pateloperation crossfire hurricanepam bondiperkins coie
08 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Supreme Court Backs Trump on Deportations, but with a Catch...
#voter fraudvladimir zelenskyukraine waralien enemies actconspiracy theorieseconomic collapsefederal reserveforeign policygeorge sorosjerome corsijohn robertsjudicial tyrannyjulian assangemueller investigationsusan crawfordswiss americatren de agua
07 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump’s Tariff Plan is Coming Together While the Left Acts Out
#zelenskyukraine warswiss americaclinton foundationconspiracy theoriesdonald trumpeconomic policyforeign interventiongeorge sorosglobalismjerome corsijoe bidenklaus schwabmaidan rebellionmueller investigationpolitical corruptionsusan crawford
04 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Defending Religious Freedom in the U.S. with Chaplain Gordon (Dr. Chaps) Klingenschmitt
#sec nav instruction 17307creligious freedompray in jesus name ministriesabortion rightsbiden administrationchristian persecutioncountry of particular concerndonald c winterdr chapsemtalafirst amendmentgordon klingenschmittjohn warnermanipurmilitary policy
03 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#scientific consensusreligious libertyrachel carsonbrian sussmanclimate callclimate changeclimate cultclimategatedan ratherdr jerome corsieco tyrannyenvironmental movementfrederick engelsgeoengineeringmalthusian theorymarxismmichael mann
02 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside Hollywood’s Whitewashing of the Catholic Church Coup Against Pope Benedict
#wuhan pandemicthe two popestheodore mccarrickalliance for prosperityan almost insurmountable evilcatholic churchciaconspiracy theoriesglobalismhigher ground productionsjerome corsijorge bergogliojuan orlando hernandezmedia censorshipmike mccormickobama biden administrationpolitical influencepope benedict xvipope francis
01 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#sidney powellscott wiperrussian ambassadordeep statedefense intelligence agencydocumentary filmmakingfbifixing intelflynn the moviegeneral michael flynnjerome corsilori flynnmichael flynnmueller investigationobama administrationplea bargaining
2025 - March (21)
31 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Zelenskyy Tries to Back Out of Rare Earths Deal, Re-Igniting World War III Worries
#xrpvolodymyr zelenskyvladimir putinandrew paquetteantifablack lives matterciadeep statedonald trumpelection fraudfinancial collapsegeorge sorosjudge boasbergnew world ordernsaswiss americaukraine war
28 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Malcom Perry, The Man Who Tried to Save JFK: What Did He See? with Dr. Juliette Engel
#warren commissionsecret serviceparkland hospitalbethesda naval hospitaldavid manticdr juliette engeldr malcolm perryearl roseforensic evidencegovernment conspiracyjohn f kennedyjohn f kennedy assassinationjudge wardlee harvey oswaldmilitary industrial complexmkultramkultra program
27 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Tackles Election Integrity, RussiaGate in Latest EOs, Putting Dems inro Another Tizzy
#voter fraudvladimir zelenskyswiss americacrossfire hurricanedepartment of homeland securitydonald trumpelection integrityexecutive ordersgeorge sorosgods five stonesjoel corsijohn robertsjudicial impartialitykatecorsinationmy vital crussiagatesocial security administration
26 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Veterans First Project: Taking Care of and Housing for Those Who Served. Introducing Modern Towers.
#veteran suicideveterans for trumpveterans for america firstcareer source south floridacommunity buildingderek stormshomeless veteranshomestead floridahousing firstjoel corsijoshua maciasmiami barber institutemodern towersnet zero energyppp voucherspresident trumpveterans first project
25 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvalerie jarretttrump impeachmentassassination of jfkbruce ohrcarlo maria viganòchristopher steeleconspiracy theoriescoup détatdeep statedonald trumpjerome corsijohn f kennedyjohn mccainmichael isikoffnew world orderseth richthe final analysis
24 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the #JFK Assassination: The Medical Cover-Up
#thomas boswellthe assassination of john f kennedy the final analysistexas school book depository9 11bethesda naval hospitalcia constructive government narrativedavid manticdeep state liesdr crenshawdr jerome corsiforensic evidencegovernment conspiracyjames humesjfk assassinationlee harvey oswaldmedical cover upparkland hospitalsecret serviceskull x rays
21 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive
#vietnam wartriple underpassthomas mills9 11ciaconspiracy theoriesdavid osbornedeep statedr malcolm perryevalia glangesforensic evidencegeorge whitaker sriraq warjerome corsijfk assassinationjohn f kennedynational archivesrobert harrisonstavis ellisthe assassination of john f kennedy the final analysis
20 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left Knowingly Lied All Along: It's Time to Investigate Them
#wisconsin state board of electionvoter registrationsusan crawfordbarack obama birth certificateconspiracy theoriescovid 19 origincultural criticismdisney snow white remakeelection fraudgeorge soroshunter biden laptopjerome corsijfk assassinationpeter dinklagepolitical corruptionrachel zieglersteele dossier
19 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Who Is Radical Judge James Bosaberg, Who Tried to Stop Illegal Immigrant Gang Deportation Flights?
#voter registrationvladimir putinukraine warbianca lynn breezebill barrelection frauderic hovdefisa courtgods five stonesjames boasbergjerome corsijfk assassinationjohn robertslee harvey oswaldmary mccordpeter titkinsupreme courtsusan cantorsusan crawford
18 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Democrats in a Tizzy over Venezuelan Gang Deportations, Biden’s Autopen Consequences
#zelenskyvoter roll integrityukraine warandrew weissmanconspiracy theoriescoup detatdonald trumpelection fraudgods five stoneshamashelp america vote actimmigration policyinternational conflictjerome corsijoe bidenmueller investigationpam bondi
17 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukrainian-American Wrongfully Persecuted by the DHS: Dmitry Kudryn Tells His Story
#voter registration integrityukrainian heritagespecial agent tide bishopcouchgate casedepartment of homeland securitydhs prosecutiondimitri kudrindonald trumpelon muskjerome corsimike novapeter ticktonpolitical pardonspresident zelenskyrussian ukrainian conflictsoviet kgb
14 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Coming Documentary to Expose Info on UFOs/UAPS
#zelenskyusaid fundinguap disclosureactblueamaryllis fox kennedyanti vaccine movementcloward piven strategycolumbia universityconspiracy theoriescorsi nationdepartment of justiceeconomic collapsejames comerjerome corsijohns hopkinsmrna vaccinespolitical corruptionsilicon satan
13 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Secret Rituals: The Darkness Underneath the Silcom Valley Elite, Part 4
#world trade centersilicon valley cultsilicon satanbook of revelationbuilding 7ciaconspiracy theoriescraig lunddeuteronomyjeffrey epsteinjerome corsikennedy assassinationluciferian cultmetaversep diddypolitical corruptionreligious conflictsatanic rituals
12 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What’s Going on, Pam Bondi? Where Are the Investigations?
#usaid document destructiontesla attacksreligious politicsarchbishop viganoattorney general investigationsconspiracy theoriesdeep state corruptioneconomic crisisepstein evidenceerica carrfederal reservej6 committeejack posobiecjerome corsikash patelmatt gaetznational debtpam bondipope francis
11 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did Jake Sullivan Tip Joe Biden’s USAID-Burisma Kickback Scheme?
#yevgeny vindmanvatican corruptiontheodore mccarrickalexander vindmanbiden ukraine scandalburismacarlo maria viganòcia influencecolor revolutionsdevin archergeorge soroshunter bidenhunter biden burismajake sullivanjoe bidenjorge bergogliometabiotametabiota kickbacksmike mccormickpope francis
10 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Russia’s Kursk Offensive; Dem Fundraising Arm in Big Trouble
#zelenskyvoter registration listsus military aidabraham accordsalgorithmic gerrymanderingbuilding 7conspiracy theoriescryptocurrencyelection integritygods5stonescomgovernment bureaucracyisrael palestine conflictjerome corsijfk assassinationjulian assangekursk offensivemaidan rebellionmueller investigationsyria massacrestrump re electionukraine war
07 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Hidden Darkness Behind the Silicon Valley Elite 2: with Silicon Satan author Cregg Lund
#silicon valley elitesilicon satansatanic ritualsandrew tatebarack obamaconspiracy theoriescraig lunddonald trumpepstein filesjerome corsilarry ellisonlucifer warsnorman vincent pealeoprah winfreyp diddyred scarfingreligious conflictrobin williams
06 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
EU Tough-Talk Bringing World Closer to World War III; Trump's Final Ultimatum to Hamas
#zelenskyvladimir putinunconspiracy theoriesdeath valleyelection fraudemmanuel macronforeign policyhamasisrael hamas warjerome corsijohn podestamail in ballot fraudmueller investigationnatoroe v wade
05 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Addresses State of the Union; BlackRock Buys Several Panama Ports
#xrpreligious nationalismpolitical polarizational greenamtrakblackrockdonald trumpeconomic policyhillary clintonhutchinson ports groupimmigration reformisisjerome corsijohn kerryjohn mccainpanama ports company
04 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Untold Stories of Ashli Babbitt and the Women of January 6th with Jack Cashill
#world economic forumroseanne boylanray eppsantifaashley babbittblack lives matterbrian sicknickconstitutional crisisgovernment conspiracyjack casheljanuary 6th insurrectionjapanese internmentkamala harrislila morrismedia censorshipmichael byrdpolice misconduct
03 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Zelenskyy's White House Hissy-Fit Aftermath and the EU's Flimsy Tough Talk
#xrpvoter fraudvolodymyr zelenskyychuck schumercollateralized debt obligationscorsinationcrypto regulationglobal financial crisisjake sullivanjerome corsinato obsolescencepeter ticktonrocky rockfordtrump gazaukraine conflictvictoria nuland
2025 - February (20)
28 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the CCP's Bioweapons Research and Measures Taken to Hide it with Dr Li-Meng Yan
#xi jinpingwuhan international airportuniversity of hong kongbioweapon theorychina disinformationchinese communist partycovid 19 originsdr li meng yangain of functiongain of function researchjerome corsimilitary civil fusionpeoples liberation armypeter daszakralph baricreceptor binding domainshi zhengli
27 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State’s Evil Intentions Behind the CONCLAVE Movie with Mike McCormick
#wuhan plandemicworld economic forumsynodal movementarchbishop viganocardinal theodore mccarrickcatholic churchconclaveconspiracy theoriesdeep statejaccusejoe bidenjorge bergogliolgbtq ideologymike mccormickobama deep statepolitical corruptionpope francis
26 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putting Patients in Charge of Their Health Care w Dr. David Hartsuch: Part 2 - Hyperbaric Treatments
#vaccine skepticismrobert kennedy jrpharmaceutical industryanthony faucibh2bh4big farmconspiracy theoriesdavid hartsuchdeep statedonald trumphealthcare reformhyperbaric oxygen therapyjerome corsijfk assassinationlee harvey oswaldnew world order
25 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi Talks with Susan Olsen: Cancelled from a Brady Bunch Revival, Growing up in Hollywood, Thoughts on Today's Issues
#susan olsenrobert f kennedy jrreligious freedombrady bunchchild actorscovid 19deidonald trumphydroxychloroquineivermectinjerome corsijudeo christian valuesmanson familymedia censorshipmmr vaccinepolitical polarizationpublic health policy
24 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About Volodymyr Zelenskyy from Fellow Ukrainian Entertainer Mike Nova
#yuri kostiukvolodymyr zelenskyyvolkswagen commercialdepartment of homeland securitydimitri kudrindonald trumpdrug abuseimmigration lawmike novareligious freedomron corsiruslan hanumakukraine warukrainian law 3894
21 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Kash Patel Confirmed as Deep State Rats Freak Out
#silicon satanroger stonereligious scandal2008 subprime crisisadam schiffcatholic church scandalcriminal justice reformdeep state conspiracyeconomic collapseimmigration policyjerome corsijulian assangekamala harriskash patelkathy hochulmises institutemueller investigationpodesta emailspope francis
20 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Calls Out ‘Dictator’ Zelenskyy; Pope Francis’ Declining Health: What Happens Next?
#volodymyr zelenskyyvaddy leakssilicon satancarlo maria viganòcatholic churchcraig lundelection integritygods five stonesgovernment overreachimmigration policyjerome corsikathy castorkathy hochulpeter ticktonpope francisreligious freedomroe v waderussia ukraine war
19 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dems Still Tizzied over Government Overhaul, Zelenskyy Should Face Election as Part of Peace Plan
#volodymyr zelenskyvatican conspiracyukraine warcarlo viganodepartment of government efficiencyelection integrityelon muskgovernment efficiencyjerome corsikathy castormarco rubiopeter ticktonpope francisrocky rockfordsergei lavrovstephen miller
18 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Hidden Evil Surrounding the Dark Alliance Between the Deep State and Deep Church
#wuhan pandemictheodore mccarrickpope francisalliance for prosperitycatholic churchdeep stateforeign policygeneral john f kellygeneral mark milleyimmigration crisisjerome corsijohn podestajuan orlando hernandezkash patelmike mccormickoperation condorpam bondipandemic origins
17 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putting the Patient Back in Charge of His or Her Own Health Care with Dr. David Hartsuch: Part 1
#walter bradleyroe v waderobert f kennedy jrcommunist partyconspiracy theoriesdonald trumpdr david hartsuchedward fogartyhealthcare regulationhyperbaric oxygen therapyiowa board of medicinejfk assassinationmedical disparitiesphyllis schlaflypolitical ideologyreligious freedomrichard nixon
14 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Darkness Hidden Under Silicon Valley's Cloak with Corinne Lund - Part 2
#smith mundt actsilicon valleysilicon satanbaby roastingbarack obamaconspiracy theoriescorinne lundcraig lundhuman sacrificejeffrey epsteinjerome corsilarry ellisonluciferian elitemark zuckerbergpolitical corruptionreligious extremismsatanic conspiracy
13 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DOGE Keeps Winning, Deep State Rats' Defense Crumbling
#ukraine russia warthe truth centralrobert f kennedy jrdogedonald trumpelection integrityelon muskfederal bureaucracyimmigration policyjerome corsikathy hochulmanufacturing declinemaxine watersmedicaidmedicarenancy pelosipam bondipeter titkin
12 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DOGE Continues to Steamroll Bureaucracy, Expose USAID Abuses
#xrp ledger technologyvolodymyr zelenskyusaid reformdepartment of justicedonald trumpelection integrityfinancial regulationgods five stoneshamasjerome corsijudicial independencelindsey grahammark fogelmiddle east conflictnancy pelosiroe v wadesamantha powersthetruthcentralcomukraine peace effortsusaid
11 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump's Hamas Ultimatum; A Dem Advisor Says Biden's Presidency was Obama's 'Third Term'
#usaidukraine warrocky rockfordcarlo maria viganòdeep statedeep state conspiracydonald trumpelection integrityelon muskgaza purchasegreen new dealjerome corsijim acostamedia censorshipmiddle east policypeter ticktonpope francisreligious freedom
10 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will Trump's Plans for Gaza Work? Corrupt Voter Roll Algorithms Found in Florida?
#voter fraud allegationsvenezuelausaidcarlo maria viganodeep state conspiracydonald trumpeconomic recessionelon muskgazagreen new dealhamasisrael hamas warjerome corsijim acostapeter ticktonreligious freedomrocky rockford
07 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left’s DOGE Meltdowns Continue as Corruption and Abuse Continue to be Exposed
#usaidreligious freedompope francis2024 electionandrew paquetteantifabiden administrationblack lives mattercarlo maria viganòchuck schumerdeep statedemocratic partyelection fraudelon muskhakeem jeffriesjerome corsineo marxismpeter tiktin
06 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DOGE Reveals More Egregious USAID Abuses as Democrats Continue to Melt Down
#usaidreligious freedompope benedictarchbishop viganociaconspiracy theoriesdogedonald trumpelection integrityforeign aid corruptiongovernment surveillancegreen new dealisisjerome corsijfk assassinationjohn thomas leelee harvey oswaldpeter titkin
05 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump’s Plans for Gaza, Iran, Downsizing the CIA
#un refugee agencytulsi gabbardreligious politics2020 electionabraham accordsarchbishop higanobob fettermanciacia reformdeep statedonald trumpelection integritygazagods five stonesgovernment downsizingiran sanctionsisrael hamas warjerome corsikash patelpam bondi
04 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did the Deep State and the Deep Church Accommodate Drug and Child Trafficking Out of Honduras?
#vatican conspiracytom donilonpope francisalliance for prosperitycardinal mccarrickchild sex traffickingdennis mcdonoughdrug traffickingel chapohondurasimmigration policyimpeachmentjerome corsijoe bidenjuan orlando hernandezmike mccormickobama biden administration
03 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump, Musk Target USAID Abuses; Zelenskyy Says He Only Receved $75B of $177B Aid
#vatican conspiracyusaid reformusaidanti globalist alliancecarlo maria viganòdeep statedepartment of government efficiencyeconomic collapseelon muskgeorge sorosglobalist agendagovernment efficiencyjerome corsimark finchemoffice of personnel managementpope francis
2025 - January (22)
31 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Washington Helicopter-Plane Crash: Beyond the Headlines
#swiss americarobert f kennedy jrrichard blumenthalaviation safetybernie sandersbiden administrationconspiracy theoriescritical race theorydeidepartment of transportationeconomic collapseelection fraudelizabeth warrenfaagods5stonesjerome corsikash patelpete buttigiegpolitical corruption
30 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About What Happened and What's Happening with the January 6th Protesters: J6ers Speak Pt. 2
#washington gulagvets for trumptrump pardonsashley babbittbank of americabenjamin phillipbrian sicknickcivil rightsdeep stategeorge sorosjanuary 6thjerome corsijoshua maciaskevin greesonlegal obstacleslindsey grahammatthew huddleroseanne boylan
29 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About What Happened to the January 6th Protesters: J6ers Speak Pt. 1
#veterans for trumptucker carlsonselective prosecutioncapitol policeconstitutional rightsdeaderek stormsdojfederal overreachjanuary 6thjerome corsijoshua maciasjudicial systemmark ibrahimmarxist stylepresidential pardon
28 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
he US’ Big Media Oligarchy RFK Jr, Gabbard to Face Confirmation Hearings
#teresa milo young bluntswiss americapolitical corruptioncorsi nationcraig lundcultural marxismeconomic collapseelaine chaoelection integrityfelix ophelia bucholdimmigration policyjack smithjd vancejerome corsijim acostaklaus schwabmedia censorshipmerrick garlandmitch mcconnellnew world order
27 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Plagiarism in Academia: the Decline of Academic Integrity and Leadership with Dr. Carol Swain
#trump executive orderthe gay affairplagiarismacademic integrityart lafferblack faces black interestscancel culturecarol swainclaudine gaydei programsharvard universityidentity politicsjerome corsikamala harrismartin luther king jrmeritocracynational science foundation
24 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Deep State Judges Purposely Slow-Rolling Release of Pardoned J6 Protesters
#silicon valley criticismsilicon satanrfk assassinationconspiracy theoriescraig lunddonald trumpdonald trump presidencyeli cranejanuary 6 insurrectionjeffrey epsteinjerome corsijfk assassinationjudge kellyjudge nicholsmlk assassinationp diddyreligious fundamentalism
23 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Darkness Under the Cloak of Silicon Valley with Corrine Lund
#vaccine advocacytrumpsilicon valleyadrenochromealliance defending freedombaby harvestingconspiracy theoriescorrine lundcraig lunddepopulationdiablo nuclear power plantjeffrey epsteinjerome corsip diddyreligious freedomsatanic ritualssilicon satan
22 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Trump Administration is Off and Running: DEI is Dead, J6 Protesters Pardoned and More
#transgender rightsoperation warp speedmrna vaccinesanthony faucibiden administrationbill gatesdei cancellationdonald trumpeconomic collapseglobalist conspiracygold rushjanuary 6th insurrectionjerome corsikash patellauren boebertlgbtq+ criticismliz cheneymark zuckerberg
21 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvatican iithe truth centralbruce ohrcarlo maria viganòchristopher steeleciaconspiracy theoriesdeep statedonald trumpdoug hornfusion gpsjerome corsijfk assassinationjohn f kennedynew world orderrobert muellerrobert mueller investigationseth rich
20 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Al Gore's Climate Alarmism Rejected by His 'Mentor;' New Documentary from Joel Gilbert
#world economic forumwind energythe climate according to aiai technologyal gorecarbon dioxideclimate changejerome corsijoel gilbertour plundered planetreligious zealotryroger revellescientific fraudsherwood idsosolar energy
17 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Treniss Evans: The Man Who Stood Up to Biden DOJ’s Persecution
#treniss evansselect committeeroger stonealex jonesbop manualbrian sicknickcall it insurrection comradecolorado ballot trialcondemned usaelection fraud claimsfbi entrapment allegationsfreedom plazajanuary 6th insurrectionjudge friedrichlawfare against protestersobstruction of congress chargespost hill press
16 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside Hollywood’s Whitewashing of the Catholic Church Coup Against Pope Benedict
#wuhan plandemicthe two popestheodore mccarrickalliance for prosperityan almost insurmountable evilarchbishop viganocatholic church corruptiondeep state conspiracydr jerome corsihigher ground productionsjoe bidenjorge bergogliolgbt agendamike mccormickobama administrationpope benedict xvipope francis
15 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pete Hegseth Weathers Attacks from Senate Democrats During Confirmation Hearing
#zero hedgewildfire disasterssenate confirmationsclifton carterconspiracy theorieseconomic crisiselizabeth warrengreenlandjohn f kennedykaren basslos angeles fireslyndon b johnsonmack wallacemazie hironomilitary interventionpete hegsethrichard blumenthal
14 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
California Fires Reveal Incompetence of Woke Officials; The WEF’s True Carbon Tax Motives Exposed
#zelenskyworld economic forumukraine waragenda 2030barack obamablackrockchristy crowleyclimate changeconspiracy theoriesdemocratic partydonald trumpelection integrityeric hovdegavin newsomisisjerome corsijfk assassinationjoe bidenkamala harris
13 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Leftists Move Hard on Global Destabilization Before Trump Takes Presidency
#united nations 2030 agendatrump presidencyswiss america15 minute citiescalifornia firesciacorsi nationdeep statedei initiativeseconomic collapseelection integritygavin newsomglobalist agendagods five stoneshegelian dialecticsjanuary 6thjerome corsimaui disaster
10 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State’s Evil Intentions Behind the CONCLAVE Movie with Mike McCormick
#world economic forumtheodore mccarrickpope francisarchbishop viganocatholic churchciaconclaveconspiracy theoriesdeep stateglobalismimpeachmentjaccusejerome corsijoe bidenjorge bergogliomike mccormickobama deep state
09 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Woke Mismanagement and the LA Wildfire Disaster
#wildfire managementsocial issuesseth richconspiracy theoriescoup detatdiversity equity and inclusioneconomic policyfive eyesjoe bidenjulian assangekaren basslinda floreslos angeles wildfiresmojave desertmueller investigationpolitical corruptionroe v wade
08 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Evidence Comes Out About the Obama CIA’s, FBI’s Russian Collusion Hoax and Coverup
#veterans affairsthetruthcentralreligious fundamentalismarchbishop viganoconspiracy theoriescoup detatdonald trumpelection integrityfive eyesgovernment surveillancejerome corsijohn brennanjustin trudeaumar a lagomatt taibbimichael schellenbergerpalisades firepolitical extremism
07 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trudeau Officially Resigns as Globalist Rats Continue to Scatter
#ukraine warswiss americareligious valuesboeingcanadian politicschrystia freelandcraig lunddepartment of justicediversity equity and inclusionelection integrityfrançois philippe champagnegestapoglobal economic collapsehunter bidenjanuary 6th insurrectionjoe bidenjustin trudeaukamala harriskgbmike mccormickp diddy
06 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Heck Did Biden Give George Soros and Hillary Clinton the Congressional Medal of Freedom?
#ukrainethetruthcentralmueller investigationbricscongressional medal of freedomdemocratic partydonald trumpelection integrityfive eyesgeorge sorosglobal economic collapsehillary clintonjanuary 6 insurrectionjerome corsijoe bidenjuan merchan
03 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden Administration Considered Attacking Iran
#wisconsintrump administrationthe truth central9 11 attacksarizonabarack obama birth certificatebiden administrationbuilding 7conspiracy theoriescritical race theoryeconomic collapseelection irregularitiesforeign policyiran nuclear facilitiesjerome corsikash patellee harvey oswaldmichigannevadapennsylvania
02 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The New Year’s Terrorist Attacks: What We Should Be Asking About Them
#trump international hoteltesla cybertruckterrorist attacksconspiracy theoriesdemocratic partydow jones industrial averageeconomic collapsefbifederal reserveisisjerome corsijfk assassinationlas vegasnew orleansobamapolitical extremismreligious freedomshamsuddin jabbar
2024
2024 - December (20)
31 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
An Honest Look at Jimmy Carter’s Presidency; How Our Civilization is Destroying Itself
#the truth centralpresidential criticismpanama canalcivilization suicidecultural decaydeep statedeep state conspiracydonald trumpeconomic collapseelection fraudgods five stonesiranian hostage crisisjerome corsijimmy carterjoe bidenmichael snyder
30 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing Corruption of the Deep State and Biden Admin as Trump Prepares for Presidency
#yuval noah harariworld war iiiwoke agendabiden administrationcultural marxismdeep statedemocratic partydepartment of justicediversity equity and inclusiondonald trumpelection fraudjerome corsinational debtrobert muellerukraine conflictvladimir putinvoter fraud
27 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pleiotropic Medicine and Hyperbaric Research: The Future of Health Care
#truth centralpaul harchmercury containing ballistic evidencebig pharmabobby koskadeep state conspiracydementia treatmentdr edward fogartydr jerome corsidr manticeden carlsonforged autopsy x raysgetlongevitymedscomglutathione supplementshbothyperbaric oxygen therapyjohn f kennedy assassinationmedical censorship
26 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Malcom Perry, The Man Who Tried to Save JFK by Performing a Tracheotomy: What Did He See?
#university of washingtonparkland hospitalmkultrabethesda naval hospitalconspiracy theoriesdavid manticdearborn michigandr jerome corsidr juliet engeldr malcolm perrygovernment cover upjfk assassinationjohn f kennedylee harvey oswaldmilitary industrial complex
23 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive
#warren commissionthe final analysisstavis ellisalton photographsciaconspiracy theoriesdeep statedr manticford motor companygeorge whitakergovernment cover upjerome corsijfk assassinationjohn f kennedylee harvey oswaldmalcolm perrynational archivesrobert harrisonsecret service
20 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
No, It's Not Okay for the Government to Constantly Lie to Us, What Today's Leaders Can Learn from History
#washington postwall street journaltransgender rightsbiden administrationbill gateschristopher wrayclimate change denialdonald trumpeconomic collapseelection interferenceigor shafarevichjerome corsijohn robertsjonathan cahnjulian assangemerrick garlandmeta instagramnew york timessocial media censorship
19 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Defending Religious Freedom in the U.S. with Chaplain Gordon (Dr. Chaps) Klingenschmitt
#usa fencingtransgender issuessecnav instruction 17307cabortion rightschristian persecutioncountry of particular concerndonald c winteremtalaeva edelgordon klingenschmittgovernment overreachjerome corsilawfaremilitary chaplainspray in jesus name ministriesreligious freedomron wagner
19 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What Forensic Research Reveals About JFK's Assassination and What the Government Tried to Hide
#warren commissionthe final analysissingle bullet theoryalan dullesbethesdaciaconspiracy theoriesdavid banticdr jerome corsigovernment cover upjfk assassinationjohn f kennedylee harvey oswaldlyndon johnsonnational archivesparkland hospital
17 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Jean Baudrillard, Post-Modernism, the Matrix and the Truth
#woke culturetransgender issuesthe truth centralanarchyclimate sciencecultural maoismdr jerome corsifrankfurt schoolgulf warhydrocarbon fuelsjean baudrillardneo marxismpostmodernismsimulacrasimulationthe matrix
16 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putting Patients in Charge of Their Health Care w Dr. David Hartsuch: Part 2 - Hyperbaric Treatments
#vaccine skepticismthetruthcentralcomswiss americaalternative medicineanthony fauciatrial fibrillationbrazil nutsconspiracy theoriesdonald trumpdr david hartsuchdr jerome corsifdahealthcare reformhyperbaric therapyjfk assassinationnew world orderrobert kennedy jr
13 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putting the Patient Back in Charge of His or Her Own Health Care with Dr. David Hartsuch: Part 1
#vaccine mandatesrobert f kennedy jrrichard nixonconspiracy theoriesdonald trumpdr david hartsuchdr jerome corsidr zelenkohealthcare reformhyperbaric treatmentsiowa board of medicinejohn f kennedy assassinationmedical freedomphyllis schlaflypolitical conservatism
12 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Totalitarians Have Adopted the "Man-Made Climate Change" Agenda
#truth centraltotalitarian controlsecular religion15 minute citiesalec epsteinbitcoin miningclimate change denialclimategatedr jerome corsigender identity politicshydrocarbon fuelsmatthias desmetmichael schellenbergerpostmodern marxismregulation mania
11 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Howard Zinn’s False History and its Damage to the Quality of American Education
#thomas jeffersonthe truth about neo marxismsaul alinskyanarchybarack obamacritical race theorycultural maoismeconomic collapsefrankfurt schoolgettysburg addressglobalismherbert marcusehoward zinnisrael hamas conflictjerome corsimichelle obamaneo marxismpeoples history of the united states
10 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Persecuted for Exposing Potential COVID Vaccine Dangers: Dr. Charles Hoffe's Story
#vaccine safetyspike proteinsmyocarditisastrazeneca vaccinebill 36blood clotscollege of physicians and surgeons of british columbiacovid 19 policydr charles hoffdr peter mccullochdr pierre coreygivesendgohealthcare autonomyinformed consentivermectinlipid nanocapsulesmedical censorship
09 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will Joe Biden Pre-Emptively Pardon the J6 Committee? Syria’s Assad Regime Falls
#tulsi gabbardthe final analysispope francisadam schiffanthony faucibiden self pardoncoast to coast amdeep state conspiracyelection fraud claimsgeneral milleygods 5 stonesjanuary 6th committeejerome corsijfk assassinationliz cheneyoperation crossfire hurricanepolitical corruption
06 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Analysis: Tucker Talks with Russia’s Lavrov; David Hogg Wants to Run the Democrat Party
#tucker carlsonswiss americasergei lavrovazov brigadesbill gatesdavid hoggdeep state conspiracydemocratic national committeedemocratic party critiqueeconomic collapsegun rights debatejerome corsiklaus schwaboreshnik missilerussia ukraine war
05 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#social justicescientific skepticismrachel carsonbrian sussmancarbon neutral gridclimate changeclimate cultclimategateecotyrannyenvironmental policyfriedrich engelsgeoengineeringgreen new dealjerome corsimarxismmilgram experimentpaul ehrlich
04 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Democrats' Devious Smear Campaign Against Pete Hegseth
#volodymyr zelenskytucker carlsontony blinken14th amendmentbiden administrationbricsburismaconspiracy theoriescraig lunddonald trumpeconomic collapseelection fraudforeign policygods five stoneshunter bidenjerome corsipolitical corruption
03 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Untold Stories of Ashli Babbitt and the Women of January 6th with Jack Cashill
#zachary alamworld economic forumroseanne boylanantifaashley babbittbenjamin phillipsblack lives matterbrian sicknickelection integrityfalse flag operationsjack cashilljacobinsjanuary 6th insurrectionjapanese internmentkevin greesonmedia censorshipmichael byrdpolice brutalityray epps
02 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Joe ‘Nobody is Above the Law’ Biden Pardons Hunter; The Trump Effect Leaves the Deep State in Fear
#watergatevoter fraudukraine ceasefireandrew paquettecalifornia 28th districtclone detection methodologyconstitutional rightselection integrityforeign policyhunter bidenjanuary 6thjoe bidenkeith kelloggpolitical corruptionrobert muellerroger navarrosteve bannon
2024 - November (20)
29 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Walter Duranty: Stalin’s PR Agent for the New York Times
#world economic forumwalter durantyukrainian faminealeister crowleycarlo viganocultural maoismgareth jonesglobalist conspiracyjerome corsijoseph stalinmalcolm muggeridgeneo marxismnew york timesnkvdpope leo xiiisj taylorstalin regime
27 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why NATO’s Tough Talk of a Pre-Emptive Attack on Russia Will Backfire
#yuval noah hararivoter fraudukraine warandrew paquettearchbishop viganobiden administrationcalifornia district 28economic preparednesselection integrityforeign policygods five stonesjerome corsikamala harrismichael waltznatonato strategyrussiasebastian gorkaswiss america
26 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
he Truth About the CCP's Bioweapons Research and Measures Taken to Hide it with Dr Li-Meng Yan
#zxc21zc45xi jinpingbioweapon theorychina policychinese communist partycovid 19 origindr li meng yangain of function researchjerome corsipeoples liberation armypeter daszakralph baricshi zhengliuniversity of hong kongwho integritywuhan international airport
25 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Woke Be Damned: Bring Back Science with John Droz, Jr
#telenorsubstackreligious fundamentalism2020 electionclimate changecritical thinkingeducation reformelection integrityframework for science educationjohn droz jrlockdownsnext generation science standardsnorth carolina primarypandemic management
22 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More States To Investigate Election Integrity; Ukraine-Russia Conflict Inching Closer to World War
#zelenskyvladimir putinukraine russia warandrew paquetteconspiracy theoriescrimeademocratic partydonald trumpelection integrityeric havdijerome corsijohn f kennedy assassinationkamala harrisnatotammy baldwinthe final analysis
21 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#turkeysidney powellscott wiperbarack obamadeep state conspiracydonald trumpfbi entrapmentflynn the moviegeneral michael flynnisisjerome corsijim clapperjohn brennanmedia censorshipmike pencemueller investigationrance priebus
20 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Continues to Assemble His Team as Corrupt Dems Go into Sabotage Mode
#ukraine warswiss americareligious valuescarlo maria viganodeep stateelection fraudfinancial crisisgods five stoneshunter biden laptopjames comeyjerome corsijohn kellymarco rubiomark espermatt gaetzmodern monetary theorynoah hararioperation crossfire hurricane
19 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukraine Launches ATACMS Missiles on Russia, Putin Lowers Nuclear Strike Threshold
#voter fraudvladimir putinukraine war2026 electionsatacms missilesbiden administrationcritical theorydeep statedonald trumperic hovdejerome corsimatt gaetzneo marxismnuclear conflictpennsylvania supreme courtsilicon satanswiss americathetruthcentral
18 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is Biden Trying to Start World War 3 as He Tries to Seal His Legacy?
#the truth centraltammy baldwinsilicon satanarchbishop viganobig pharmaconspiracy theoriescraig lunddonald trumpeconomic collapseelection frauderic hovdeforeign policyhillary clintonjerome corsijoe bidenkamala harrisoperation crossfire hurricanereligious extremism
15 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Democrats Reveal their True Selves Through Post-Election Day Weasel Tactics
#wisconsin electionsvoter fraud allegationsreligious conservatismbob caseyciaclone votersdeep statedeep state conspiracydepartment of justicedonald trumpeconomic inflationelection integrityfbigjensidiegold and silverjerome corsipennsylvania elections
14 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are the Democrats Trying to Steal the PA Senate Race? The Left’s Plans to Undermine Trump are Underway
#the truth centralswiss americaperkins coiearchbishop viganocivil unrestcryptocurrency regulationdave mccormickdonald trumpelection fraudforeign policygods five stonesjerome corsilawfaremark eliasmelania trump
13 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State’s War Against Donald Trump Commences (Again)
#voter registrationthomas ligerthe truth centralandrew paquettearchbishop viganoclone recordsdeep statedonald trumpdr jerome corsielection frauderic hovdejuan merchanletitia jamesmail in ballotsphil andersonpolitical conspiraciesstormy daniels
12 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden, Obama Administrations’ Corruption and Collaboration with the Deep Church
#vatican politicstheodore mccarrickpope francis2020 election fraudalliance for prosperityan almost insurmountable evilarchbishop viganobergogliocardinal parolincatholic church corruptiondeep state conspiracydennis mcdonoughjerome corsijoe bidenlgbtq rights controversymike mccormicknoah harariplandemic
11 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Effects of Exposing Corrupt Voter Roll Database Algorithms on the 2024 Elections
#ukraine warreligious freedompope francisalexander zelenkoarchbishop carlo maria viganòclimate change denialdeep state conspiracydei regulationsdonald trumpelection fraudesg regulationsglobal economic collapsegods five stoneshydroxychloroquinejensidiejerome corsijorge murillo bergogliokamala harris
08 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Continuing Research on Suspicious Algorithms in Some States' Voter Roll Databases Post-Election Day
#wisconsinvoter registrationthe georgia nerdsabsentee ballotsarizonaciadata integrityelection fraudforeign interferencegeorgiagods5stonescomjensidie insurancejerome corsikopriks grocery storengo activitypennsylvaniasouth carolina
07 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Watching the Yet-to-be-Decided Congressional Races, Letitia James Melts Down
#self directed iraneo marxismletitia jamesbrics nationsclimate change hoaxcultural maoismdemocratic partydonald trumpelection fraudgeorge sorosgold and silveripccjerome corsikamala harris
06 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Wins, GOP Headed Toward Senate & House Majority: What to Expect Next
#vibnopope francisnew york criminal sentencing2024 election resultsantifaarchbishop carlo maria viganòblack lives matterconstitutional amendmentdeep state conspiracydonald trumpeconomic collapseelectoral collegegods five stonesjeffrey epsteinjerome corsi
05 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Election Day Outlook and how Suspicious Voter Roll Algorithms in Some States May Come into Play
#nuclear warneo marxismkim brooksciaclimate changedemocratic partydonald trumpelection fraudga nerdsglobalismgooglejerome corsijoe roganjohn fettermankamala harris
04 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Deep Dive into the Latest Suspicious Voter Roll Algorithm Discoveries in Battleground States
#world economic forumtransgender rightstony schaefferantifaaocarchbishop viganobarack obamablack lives mattercherie currydemocratic partydonald trumpdr jerome corsigavin newsomglobal warminghillary clintonisrael palestine conflictjfk assassinationkamala harrispolitical conspiracypope francis
01 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Breaking Down Abilities of Suspicious Algorithms in Some States’ Voter Roll Databases
#voter fraudpaulmillstone report9 11cochise countydeep statedepartment of justiceelection integritygovernment conspiracyjd vancejerome corsijfk assassinationkamala harrismail in ballotsmarxist leninistmerrick garland
2024 - October (23)
31 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
List of Swing States with Suspicious Voter Roll Database Algorithms Grows: Breaking it Down
#voter fraudtruth centralsherrod brownandrew paquettechris gordaniclone ballotscryptographic schemesdr jerome corsielection integrityfive eyes networkfrank larosekamala harrismail in ballotsohio secretary of state
30 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Honing in on Georgia’s Suspicious Voter Roll Database Algorithms Heading into the Election 2024 Home Stretch
#voter id manipulationtransgender rightssteve bannonbrad raffenspergerbricscarlo maria viganòcraig lunddemocratic partyelection fraudfrank larosegeorgia nerdsgeorgia state board of electionsinternational relationskamala harrispolitical ideologypope francisputinreligious controversysilicon satan
29 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Swarm of Election Officials is Prepared to Spurn The Vote if Trump Wins
#silicon satanroe v wadereligious freedomadrian fontesarchbishop viganocleta mitchellclimate change denialconstitutional lawdonald trumpelection integrityfinancial crisisgold pricejerome corsijudge michael libertikamala harrisnew york timespope francis
28 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump's Historic MSG Rally; A New State Found with Corrupt Voter Roll Algorithms
#voter roll manipulationvoter registrationsuge knight2024 electionandrew paquettearchbishop viganoclone registrationsconstitutional crisisdemocratic partydonald trumpelection fraudgods five stonesjerome corsijohn boltonkamala harrisneoconservative war agendasrobert f kennedy
25 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left Wants To Again 'Fortify' The Elections, Unless Trump Wins Big
#woke culturetruth centralreligious libertyciacultural marxismdeep state conspiracydonald trumpelection interferenceforeign policyjerome corsijfk assassinationkamala harrismaidan rebellionneo marxismnsaoctober 7th hamas attackspeter moray
24 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Corrupt Voter Roll Algorithms Can Be Used and the Globalist Left’s True Agenda
#voter roll algorithmsvoter fraudtruth centraladrian fontesamerican encoreandrew paquettebuilding 7chris gordaniconspiracy theoriescovid 19 vaccinescultural marxismdepartment of justicedonald trumpelection integrityjerome corsijfk assassinationkamala harrismichael liberdipolitical polarization
23 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
On Taking Real Action Against Suspicious Algorithms in States’ Voter Roll Databases: A conversation with Lance Wallnau
#wisconsinvoter fraudtruth centralandrew paquettearizona electionchris fordennycochise countydata securitydr gerard jerome corsielection integritygovernment surveillancehelp america vote actjanuary 6thjohn eastmanmail in ballotsnew yorkohiopennsylvania
22 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Archbishop Vigano Endorses Trump in a Powerful Open Letter to American Catholics
#swiss americareligious freedommiddle east conflictbiden harris administrationbricscarlo maria viganòdeep statedonald trumpelection fraudglobal economic crisisgods five stonesgold investinghezbollahjerome corsikamala harrismichael snyder
21 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
List of States with Suspicious Voter Roll Database Algorithms Growing; Will Israel Attack Iran?
#venezuelaswiss americareligious conservatismbricsciaconspiracy theoriesdetroitdonald trumpelection integrityglobal economicsjerome corsijohn f kennedyjudge michael libertimiddle east conflictpope francis
18 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Philosophical Landscape of Informational Warfare and Enforcement of Election Integrity
#world economic forumvoter suppressionunited nationsaldous huxleyandrew paquettebarbara marx hubbardcultural marxismdulles brothersedward bernayselection integritygeorge orwellheartmath institutejean baudrillardjerome corsimind controlmkultranew world orderprescott bushstanley milgram
17 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Kamala's FOX Interview Disaster
#silicon satanreligious freedompope francisarchbishop viganobarack obamabill clintonbret baiercia conspiracycochise countydemocratic partydonald trumpelection fraudimmigration policyjerome corsijohn f kennedyjudge libertikamala harris
16 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Officials in States with Cryptographic Algorithms in Voter Rolls Are Not Taking the Problem Seriously
#wisconsinvoter registrationvolodymyr zelenskyadrian fontesdemocratic partyeconomic collapseelection fraudfrank larosegeorgia judgegodsfivestoneshawaiiinternational conflictjerome corsikamala harrisnew jerseynew yorkohiopennsylvaniasteganographyswiss americatexas
15 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Breaking: Pennsylvania Found to Have Suspicious Voter Roll Algorithm - A New Andrew Paquette Report
#voter registrationswiss americastate board of election idalgorithmic manipulationandrew paquettearizona 2020 electioncarlo maria viganòelection fraudjaccusejerome corsijudge michael j libertipennsylvania voter registrationpolitical conspiracypope francisreligious apostasy
14 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Democrats Reach New Levels of Desperation
#wisconsinvoter registrationukrainecultural maoismelection fraudgender identityglobal conflictgun rightsisrael hamas warjensidie itjerome corsikamala harriskiwi supermarketneo marxismnorth koreaoctober surprisepennsylvaniapolitical hypocrisysam elliottted walz
11 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Going In-Depth on Corrupt Voter Roll Algorithms and a Big Court Loss for the AZ Dems
#wisconsinvoter roll algorithmssmith mundt actarizonademocratic partydr jerome corsielection fairness instituteelection fraudgeorgiakamala harrismail in ballotsmaricopa countymark finchammedia censorshipmichiganohiopennsylvaniaphil evans
10 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
AZ Court Decision Strengthens Fight Against Corrupt Voter Roll Algorithms; Woodward" US Close to Nuclear War Under Biden
#nuclear war riskkamala harrisjfk assassinationamerican encore v adrian fontesarchbishop viganobiden harris administrationbob woodwardconspiracy theoriesdavid manticeconomic instabilityelection integrityequal protection clausefemagreen energy transitionhoward sterninternational energy agencyjerome corsi
09 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Updates on Research Into Corrupt Voter Roll Algorithms: A Conversation with Eric Metaxas
#voter registrationtruth centralreligious politics9 11 attacksandrew paquettecarlo maria viganòciaconspiracy theoriesdeep stateelection integrityeric metaxasjerome corsijfk assassinationkamala harrislee harvey oswaldmedia censorshipmike pompeo
08 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Al Gore's Climate Alarmism Rejected by His 'Mentor;' New Documentary Hones In on the Former 'VP's Flawed 'Science'
#vanderbilt divinity schoolthe climate according to aisherwood idsoal gorearrested by kamalaclimate changeearth in the balanceenvironmental hoaxjerome corsijoel gilbertkamala harrismedia censorshipopecour plundered planetpolitical hypocrisyrfk jrroger revelle
07 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hillary Angry Over ‘Losing Control’ Without Social Media Censorship; Suspect Voter Roll Code Found in Battleground State
#war in ukrainevenezuelan gangsukraine warbiden administrationbric nationsdepartment of educationeconomic collapseelection integritygods five stonesgold standardhillary clintonhurricane miltonimmigration policyisrael iran conflictjerome corsisocial media censorship
04 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are There Cloned Voter Registrations in Wisconsin? Why the Biden-Harris Pathetic Response to Helene?
#world war iiisocial issuesoperation paperclipbiden harris administrationclone votersconspiracy theorieseconomic collapseelection integrityelectric vehiclesfemageopolitical conflictgods five stoneshurricane heleneisrael iran conflictjerome corsijfk assassinationnew world order
03 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
'Arrested by Kamala - a Black Mother's Story' Documentary Creator Reveals Harris' Abuse of Power as CA AG
#truancy violationssickle cell anemiamaoist ideologyarrested by kamalabarack obamabarack obama birthcalifornia supreme courtcalifornia truancy lawscherie peoplesdemocratic party critiquefrank marshall davishomicide prosecutorsjerome corsijoel gilbertkamala harriskamala harris policiesmaoist
02 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Vance-Walz Debate: Analysis. Also, Will the Iran-Israel Conflict Lead to World War 3?
#wisconsin voter rollsvoter fraudtim walzatomic irancbp one appciaconspiracy theorieselection integritygeorge wallacegods five stonesisrael iran conflictjd vancejerome corsikamala harrisnsapolitical debatestiananmen square
01 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Update: Wisconsin Found to Have Suspicious Algorithm in its Voter Rolls: How to Stop the Real Steal
#ukrainian armysilicon satanoperation northern arrowsbricsconspiracy theorieselection integrityglobal economic crisishassan nasrallahisrael hamas warjerome corsijfk assassinationkamala harrislee harvey oswaldmike waltznatonuclear war
2024 - September (20)
30 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
John Kerry to World Economic Forum and the UN: ‘We Don’t Need No Stinking First Amendment!’
#world economic forumvoter suppressionun general assemblybarack obamademocratic partyeconomic collapseelection fraudfirst amendmentglobalismgold rushjerome corsijfk assassinationjohn kerrymail in ballotsohio electionsp diddy
27 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State Comes Down on Eric Adams; Harris to Suffer Fallout After Disastrous Softball Interview
#united nationsswiss americastephanie ruhledeep state conspiracydemographic declineeconomic collapseelection integrityeric adamsford motor companyjerome corsijoe bidenkamala harrismsnbcnatonuclear warohio secretary of staterussia
26 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What, Legally, Can Be Done About Suspicious Algorithms in Several States’ Voter Rolls: An Attorney’s Perspective
#voter registration fraudtom renzthe truth centralalgorithmic manipulationciaelection interferencefranklin laroseharvardjerome corsimail in ballot securitymail in votesmodular arithmeticnew jerseynew yorkohioohio attorney generalpolitical pressure
25 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Suspicious Algorithms in Several States’ Voter Rolls: How Did They Get There and Why? - with Tony Shaffer
#voter registrationtony schafferohiociadeep statedodelection integrityforensic auditsghost votersintelligence agenciesjerome corsijim clapperjohn brennanmail in ballot fraudnew yorknsa
24 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The UN Doubles Down on Agenda 2030; Blinken Hints at Elevating Proxy War vs. Russia
#united nationsukraine russia warthetruthcentralagenda 2030antony blinkeneconomic collapseglobalist elitesgods five stonesgold and silverisrael hezbollah conflictjerome corsikamala harrislloyd austinmiddle east conflictnational debtnew world governmentpact for the future
23 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Potentially Corrupt Algorithms Found in More States’ Voter Rolls: An Update
#vote harvestingtulsa oklahomap diddy scandalagenda 2030andrew paquettecnnconspiracy theoriesdepartment of justiceeducation reformelection integrityfinancial crisisforeign policyghost votersgods five stoneshamashillary clintonisrael hezbollah conflictjerome corsinew york times
20 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Behind the Kamala Harris Money Machine
#voter registration filesus intelligence agenciestransgender rightsbarack obamaburberry clothingclimate change policyelection integrityfinancial crisisgavin newsomgold investmenthillary clintonjerome corsikamala harrismark buellpolitical corruption
19 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Will Escalating Conflicts Worldwide Affect the 2024 U.S. Elections?
#yanukovychukraine conflictpope francis2024 us electionantifaclinton foundationdemocratic partydonald trumpgeopoliticsgods five stoneshezbollahiranisraelisrael hamas warjerome corsijoe bidenkamala harrismaidan rebellionpetro poroshenko
18 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
New Updates on Ohio's Investigation into a Corrupt Algorithm Within its Official Voter Database
#voter fraudthetruthcentralreligious extremismandrew paquettebiden administrationciademocratic partyelection integritygods five stonesjerome corsikamala harrismedia biasnew world orderohio voter databasepolitical conspiracy
17 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Report Filed: Cryptographic Algorithm Found in the Ohio State Board of Elections Official Voter Registration Database
#voter fraudswiss americaroe v wadeandrew paquettecryptographic algorithmsdr jerome corsielection integrityfranklin roseghost votersgods five stoneshelp america vote actmail in votingmodular mathematicsohio secretary of state
16 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Update on Ohio Corrupt Voter Roll Algorithm Investigation; Another Possible Attempt on Trump’s Life
#walking liberty half dollarvoter fraudthetruthcentralandrew paquetteconspiracy theoriesdonald trumpeconomic collapseelection integritygeopolitical conflictghost votershenry kissingerjerome corsikamala harrisnatonew jerseynew yorknsm 200ohiopolitical assassinationryan wesley ruth
13 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is the CIA Controlling our Elections? Dr Jerome Corsi's Conversation with His Glory: Take Five
#world economic forumvoter fraudtruth centralbill gatesciacritical race theorydemocratic partyelection integritygods five stonesgovernment conspiracyhenry kissingerjerome corsinational security memorandum 200new jerseynew world ordernew yorkoblaconunmdohiooklahomapennsylvania
12 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More on a Discovered Corrupt Voter Roll Algorithm in Ohio: Dr. Corsi Town Hall
#voter fraudsaddam husseinpolitical corruptionandrew paquetteanthony faucibuilding 7conspiracy theoriesdeep stateelection integrityfrank larosehelp america vote actjerome corsijfk assassinationlyndon johnsonnational security memorandum 200operation mockingbirdpentagon papers
11 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Corrupt Algorithm Found in Ohio: Suspicious Activity Suspected; Plus Post-Debate Analysis
#political polarizationohio voter registration databasenew world order9 11 attacksconspiracy theoriescultural maoismcultural marxismdavid mantekdavid muirdeep state allegationselection integritygods five stonesjerome corsijfk assassinationkamala harrislee harvey oswaldneo marxism
10 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Heading Back to Ohio as Investigations into Suspicious Voter Roll Algorithms Heat Up
#world economic forumvoter roll algorithmstranshumanism9 11 attacksanti globalist movementcaliforniadaniel estulindonald trumpelection fraudfloridagods five stonesiraq warjerome corsikamala harrisklaus schwabnew world ordernew york stateoklahomatexasthe truth central
09 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Where Dr. Corsi's Probe into Suspicious Voter Roll Algorithms in Several States is and What's Next
#voter registrationtulsathe truth centralandrew paquetteciaconspiracy theoriescurtis lemaydemocratic partydonald trumpelection fraudgeorge wallaceglobalismgods5stonescomjerome corsikamala harrisnew yorkoklahomapolitical polarization
06 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Probing the Dangerous Voter Roll Algorithms in Several States: More on The Real Steal
#voter roll algorithmsvoter fraudthe truth centralbrian katzchris cordanidata analysiselection integritygods5stonescomhuron countyjerome corsijosh jessemahoning countymail in ballot fraudmail in ballotsohio board of electionsohio electionsreal steel
05 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Probing More Deeply Into Suspicious Voter Roll Algorithms in Several States: A Conversation with Pelle Neroth Taylor
#where is the birth certificatevoter roll manipulationpolitical corruptionbarack obamaciadeep state conspiracydr jerome corsidropboxelection fraudghost registrationsgods 5 stoneskamala harrismail in ballotsoperation mulespelle neroth taylor
04 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Update on Investigations into a Corrupt Voter Roll Algorithm A Conversation with Joe Hoft
#voter fraudvenezuelatim walz2020 electionai in electionsandrew paquettecaesar cipherscryptographic analysisdr jerome corsielection integritygods5stonescomjoe hoftkamala harrismail in ballotsnew yorkohiospiral codes
03 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ohio Opens OFFICIAL INVESTIGATION into Suspicious Voter Roll Algorithm
#weapons of mass destructionvoter registrationtulsa oklahoma9 11 attacksandrew paquetteciaconspiracy theoriesdeep stateelection fraudghost votersjerome corsijohn f kennedynew york state board of electionsohio secretary of statepolitical manipulationthe war on humanity
2024 - August (22)
30 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Malcom Perry, The Man Who Tried to Safe JFK by Performing a Tracheotomy: What Did He See? with Dr. Juliette Engel
#warren commissiontracheotomyparkland hospital2 chronicles 7 14ciaconspiracy theoriesdavid manticdr juliette engeldr malcolm perrygovernment cover upjfk assassinationjohn f kennedylee harvey oswaldmedical forensicsmilitary industrial complexmkultra
29 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda (encore)
#victoria nulandvatican iithe truth centralarchbishop viganobruce ohrchristopher steeleconspiracy theoriesdeep statejerome corsijohn f kennedyjohn mccainmedia censorshipmichael isikoffmueller investigationnew world orderpolitical corruptionrobert kaganseth richsteele dossier
28 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive (encore)
#the final analysissecret servicenational archivesciaconspiracy theoriesdealey plazadeep statedr jerome corsidr malcolm perryford motor companygeorge whitakergrassy knolljfk assassinationlee harvey oswaldmilitary industrial complex
27 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the #JFK Assassination: The Medical Cover-Up (encore)
#texas school book depositoryparkland hospitalmedical forensics9 11 conspiracyair force onebethesda autopsyciaconspiracy theoriesdavid mantikdr boswelldr james humesfbi agents silbert and oneillgovernment cover upsjerome corsijfk assassinationjohn f kennedylee harvey oswald
26 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Focusing in on Screenshots and Witness Accounts of #JFK's Assassination and Evidence of the Massive Coverup
#x raystransgender ideologythe truth centralabortionalan dullesconspiracy theoriesgeorge sorosgovernment cover upsgrassy knollhillary clintonjerome corsijfk assassinationjoe bidenjohn f kennedylee harvey oswaldnicholas katzenbachpolitical corruptionreligious conservatism
23 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State, Suspicious Voter Roll Algorithms and the Anti-Globalist Manifesto A Conversation with Stern America
#voter roll algorithmsvoter registration fraudthe anti globalist manifestoanti globalismdeath valleydonald trumpelection integritygods5stonescomhsbc money launderingjerome corsikamala harrislaroseohio state board of electionspolitical conspiracy theoriessecond amendment rights
22 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing Code Embedded Into The Ohio Board Of Election Voter Registration Roll
#voter fraudthe truth centralsonoschris cordaniciacybersecuritydr jerome corsielection integritygods5stonescomgovernment surveillancekamala harrislyden av norgemail in votingnew yorknsaohiop5
21 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Real Steal Update: More on Suspicious Voter Roll Algorithms in Ohio and other states
#voter fraudvita supplementssonos devicesandrew paquettebiden administrationciacoach davecryptographic algorithmscuyahoga countydemocratic partydr jerome corsielection integrityfrank laroseluciferian influencensaohio electionsprice waterhousesatanic influence
20 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing Potential Election Interference Through a Voter Roll Algorithm in Oho: Q & A with Dr. Corsi
#voter registration fraudohio voter registration databaselao xialgorithmic manipulationanti globalist allianceanti globalist movementbarack obama birth certificatecalabresedavid manningdeep state conspiracydominion voting machineselection integrityfrank larosegods5stonescomjerome corsijohn f kennedy assassinationjulian assangekamala harris
19 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Update on the Ohio Voter Roll Algorithm and Election Interference Potential with The Resistance Chicks
#woke ideologyvoter registrationthe truth central2020 electionalgorithmic manipulationandrew paquettebarack obamaelection fraudfrank laroseghost votersjerome corsikamala harrisnew york study groupohioreligious rhetoricrepunitsresistance chicks rumble
16 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Corruption of State Voter Rolls: Focus on Ohio -- The Real Steal
#voter registration fraudtom corsisonos devicesalgorithmic manipulationanti globalist allianceelection integrityghost votesgods5stonescomkamala harrislyden av norgemail in ballot securitymikael andreasennew world orderohio board of electionsp4 radiop5 radiopolitical corruption
15 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Real Steal: Dr. Corsi Town Hall on Dangerous Voter Roll Algorithms in Some US States (Live 8/14/24, Medina, OH)
#voter registrationnsamike laroseanthony paquettebrad raffenspergerciaconspiracy theoriescryptographic algorithmsdominion voting systemsdonald trumpelection fraudguides5stonescomjerome corsijfk assassinationkamala harrisken blackwellmail in ballots
14 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Neo-Marxist Foundations of Today’s Woke Culture
#woke culturewilliam z fosterthe truth centralbarack obamabella doddbernadine dornbill ayerseconomic collapsefrank marshall davishouse un american activities committeejerome corsimarxist conspiracyneo marxismpaul robesonpoliticalcompolitical infiltrationsystemic racism
13 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Cardinal McCarrick, Pope Francis, Joe Biden, Barack Obama and their Transformation of the Catholic Church
#tony blinkenthe anti globalist manifestopope francisanita dunnarchbishop carlo maria viganòcardinal mccarrickcardinal theodore mccarrickcatholic church scandalconspiracy theoriesdennis mcdonoughdr jerome corsielection fraudhunter biden laptopjake sullivanjoe bidenklaus schwabmarco polo
12 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Starvation as a Political Weapon: The Dark History of Marxism (encore)
#world economic forumrobert muellerproposition 47christopher wraycultural revolutiondemocratic party corruptiondonald trumpeconomic crisiselection interferenceelon muskjerome corsijoe bidenjohn durhamjulian assangemar a lagomedia biasneo marxismpolitical indictments
09 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Tim Walz’s Stolen Valor Makes Him Unfit to be VP
#world economic forumvoter fraudtim walzbarack obamabill gatescatholic churchconspiracy theoriesdonald trumpjd vancejerome corsijohn f kennedykamala harrisklaus schwabpolitical corruptionreligious rhetoricstolen valorthird secret of fatima
08 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Best of Dr. Corsi: The Deep State and the Deep Church: Behind Archbishop Vigano’s Stand Against Pope Francis
#vatican coupthe case to impeach and imprison joe bidenpope francisarchbishop carlo maria viganòbarack obamacardinal theodore mccarrickcatholic churchconspiracy theoriesdeep statedenis mcdonoughgeorge soroshillary clintonhunter biden laptopjerome corsijoe bidenmike mccormickpolitical corruption
07 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Honing in on Another State With a Suspicious Voter Roll Algorithm
#voter fraudohionew york state board of elections2024 electionandrew pickettarthur morelloclone voterscripdata manipulationecho voterselection integritygopjerome corsikamala harrismail in ballots
06 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran Pledges Retaliation Against Israel: What to Expect; The Kamala Honeymoon will Soon be Over
#voter fraud allegationsthe truth centralpennsylvania voter fraud2024 us electionanti globalist manifestodemocratic party criticismdonald trumpeconomic collapsegods five stoneshunter bideniranian retaliationiran israel conflictjerome corsijoe bidenkamala harrisnew york voter fraudohio voter fraud
05 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US Markets, Nikkei Plummets: Is a Global Market Collapse Coming?
#volodymyr zelenskyswiss americasharia lawanti globalist alliancebiden administrationdeep stateelection integrity claimsglobal stock market crashgods five stonesgold and silver investinghyperinflation risksjerome corsijfk assassinationkamala harrisnational debtnikkeipolitical conspiracy theoriesreligious end times
02 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Another #WokeLympics Debacle: #IOC Defends Biological Men Pummeling Women for Sport
#woke ideologysheila jackson leereligious fundamentalismanti globalist alliancebill clintonchrisconspiracy theoriesequal rights amendmentgazagender identityiocisrael hamas warjerome corsijuanita broderickkamala harrismonica lewinskynicolás madurophyllis schlaflypolitical corruption
01 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Proof the Secret Service Lied About Trump Assassination Attempt as New Video Released Showing Shooter Walking on Roof Before Attack
#zelenko protocolssilicon satansecret serviceanti globalist alliancearchbishop viganobarack obamaconspiracy theoriesdonald trumpgods five stonesjerome corsikamala harrismkultranational association of black journalistsnikki haleyopportunity zonespope francis
2024 - July (21)
31 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Secret Service Weaknesses Exposed Over the Trump Assassination Attempt
#ted cruzsecret service corruptionsecret servicebarack obamablackrockciaconspiracy theoriesdonald trumpeconomic collapsehamashezbollahisraeljerome corsijfk assassinationjoe bidenkamala harrismiddle east conflictpolitical assassinationsrobert f kennedy jr
30 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pro-Kamala Influencers' Embarrassing Zoom Video; Thoughts on a Plan to Bolster Secret Service
#white women for kamalaswiss americasecret serviceariel frazzleat risk internationalbarack obamaconspiracy theoriesdeep statedonald trumpelection integritygods five stonesjfk assassinationjoe bidenkamala harrismrna vaccinenicolás maduropolitical corruptionreligious freedom
29 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Coronation of Kamala and Biden's SCOTUS Sore Loser Plan
#tony molinarithe truth centralswiss americaandrew paquetteat riskbarack obamaciademocratic national conventiondonald trumpeconomic collapseelection fraudglobalismgods five stonesjerome corsikamala harrismodern monetary theorysecret service negligence
26 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Kamala Harris Gaslighting Project is Underway
#zelenskytucker carlsonroe v wadeact blueanti semitismbarack obamaben carsonbenjamin netanyahubricsdonald trumpeconomic collapseelection fraudglobalist conspiracygods5stonesilhan omarjames okeefekamala harrismarxismrashida tlaib
25 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Awkward Address to the Nation; Pro-Hamas Protesters Cause Chaos in Washington
#zero hedgeunion stationswiss americaandrew paquettebricscovid 19 conspiracyeconomic collapsegods five stonesgold investingisrael hamas warjerome corsijoe bidenkamala harriskyle dean gravespolitical corruption
24 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Democrats’ Kamala Albatross More Questions Rise Over Trump Assassination Attempt
#ziko protocolsthe truth centralsecret serviceantifaassassination attemptbarack obamablack lives matterbrics nationsdeep state theorydei initiativeseconomic collapseelection fraudend times prophecyfetal tissuejerome corsijfk assassinationkamala harrismail in votingn5h1pandemic conspiracy
23 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Democrats are Stuck with Kamala Harris; The Secret Service Chief Gets Grilled from Both Sides
#swiss americapolitical corruptionkamala harris2 chronicles 7 14barack obamabird flublack lives matterbutler rallyconspiracy theoriesdeep stateelection integrityfinancial collapseglobalismhillary clintonjerome corsijfk assassinationjoe biden
22 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden Ends Re-Election Campaign: The Ripple Effects; Will Harris Really be the Dems' Candidate?
#voter fraudthe final analysissecret serviceassassination attemptsbarack obamaconspiracy theoriesdonald trumpdr jerome corsigavin newsomhillary clintonjoe bidenjohn f kennedykamala harrismail in ballot fraudmichelle obamanuclear warpolitical manipulationpresidential elections
19 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What are the Democrats’ Plans for the DNC and November?
#world war iiisecret servicereligious politics25th amendmentazithromycinconspiracy theoriescovid 19donald trumpelection fraudgetrxmedsnowcomgods five stoneshydroxychloroquinejerome corsijfk assassinationkamala harrispandemic conspiraciespolitical corruption
18 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is the End for Biden's Campaign Near? EU Globalists in a Tizzy over Orban's Meeting with Putin
#steve bannonroe v wadereligious extremismanti globalist manifestobricsconspiracy theoriescovid 19democratic partydonald trumpeconomic collapsegazajd vancejerome corsijfk assassinationkiwimedical misinformationpolitical corruptionpope francis
17 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Secret Service Chief and DEI Need to Be Fired; Is China Readying for War?
#xi jinpingukraine conflictsecret serviceanti globalist alliancebiden administrationconspiracy theoriesdeep statedonald trumpdr jerome corsieconomic collapsegold and silver pricesjfk assassinationnational securitypresidential campaigns
16 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Questions Surround Trump Assassination Attempt; Biden Blames Trump for Violent Political Rhetoric
#ukraine warsecret servicerobert f kennedy jrbiden administrationconspiracy theoriesdeep statedonald trumpeconomic collapsefederal reservegold and silverinternational corruptionjd vancejerome corsimike pencepolitical assassination
15 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Aftermath of the Trump Assassination Attempt; When Will the Global Debt 'Day of Reckoning' Come?
#zincsecret servicerobert f kennedyantifaazithromycinbird fluconspiracy theoriescovid 19dengue feverdonald trumpdr jerome corsieconomic collapsegetrxmedsnowcomgreat resethydroxychloroquineivermectinjoe bidenleapthroughcentralcompolitical assassination
12 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Malcom Perry, The Man Who Tried to Safe JFK by Performing a Tracheotomy: What Did He See? with Dr. Juliette Engel
#warren commissionparkland hospitalnurse audrey bellbethesda naval hospitalciadavid manticdr crenshawdr jerome corsidr juliette engeldr malcolm perrydr mcclellandforensic evidencegovernment conspiracyjohn f kennedykemp clarkkennedy assassinationlee harvey oswaldmilitary industrial complexmkultra
11 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did the Deep State and the Deep Church Accommodate Drug and Child Trafficking Out of Honduras?
#vatican scandalsinaloa cartelpope francisalliance for prosperityarchbishop viganobarack obamacardinal mccarrickchild sex traffickingdeep statedennis mcdonoughdrug traffickinggeneral john f kellyjerome corsijoe bidenjuan orlando hernandezmike mccormickpolitical corruption
10 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Calls for Biden to Step Down Mount; The CCP Conducts Military Exercises Near Ukraine Border
#zelenskytruth centralsinaloa cartelarchbishop viganobelaruschinaconspiracy theorieseconomic collapseel chapogeopolitical conflictgods five stonesjerome corsijoe bidennatoparkinsons diseasepeter doocypolitical corruptionpope francisreligious extremism
09 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden to Have a 'Big Boy Press Conference;' No, Wildfires Are Not Being Caused by 'Climate Change'
#the coming global crashspotted owlreligious freedom25th amendmentaaron regenbergclimate changeglobal economicsjill bidenjoe bidenjorge bergogliokamala harriskeir starmerpope francispresidential healthpublic citizen
08 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Top Dems Behind the Scenes Look to Dump Biden; A Deeper Look into the UK, France Election Results
#voter frauduk labour partypope francis2024 us election25th amendmentbird fluboeingdeep state conspiracyeconomic collapseelection integrityglobal pandemicgreen new dealjerome corsijoe bidenkamala harrisnatonuclear war
03 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Deep State and the Deep Church: Behind Archbishop Vigano’s Stand Against Pope Francis
#xi jinpingukrainetreasonalliance for prosperitycarlo maria viganòcatholic churchconspiracy theoriesdeep stategeorge soroshillary clintonhondurasimpeachmentjerome corsijoe bidenjuan orlando hernandezmike mccormickpope francistheodore mccarrick
02 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left is in a Tizzy over SCOTUS Immunity Ruling
#vatican schismtranshumanismswiss america2 chronicles 7 14archbishop viganobiden administrationcardinal mccarrickconspiracy theoriesdonald trumpeconomic inflationfreemasonrygeorge sorosglobal governancejoan corsilawfarepope francispresidential immunitysupreme court
01 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Democrats Will Not Dump Biden
#valerie jarrettsusan ricesteve bannonarchbishop viganobarack obamabjorn lomborgclaudine gaycritical race theorydeep state conspiracyend times theologygreen energy transitionjanuary 6th committeejerome corsijfk assassinationjoe bidenjulian assangekathy hochulmarine le pennational rallypope francis
2024 - June (20)
28 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Post Trump-Biden Debate Analysis; Archbishop Vigano Issues a Huge Statement
#vatican synodreligious freedompresidential competence25th amendmentcarlo maria viganòcnn debatedeep statedemocratic party corruptiondonald trumphunter bidenjeffrey epsteinjerome corsijoe bidenkamala harrislegal challengespizzagatepope francis
27 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#the truth centralsidney powellscott wiperdeep statedefense intelligence agencydocumentary filmmakingfbi entrapmentflynn the moviegeneral michael flynnjerome corsijulian assangemichael flynnmueller investigationperpetual warrussiagate
26 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Anti-Israel Squad Member Loses Primary; A Deeper Look into NY's Voting Role Algorithm
#spiral cipherrussia ukraine warnew york citizens auditandrew paquettecheap fakesdeep fakeselection fraudfederal reserveglobal economic collapseho chi minh offensiveisrael hamas warjamal bowmanjerome corsijohn kerrykenya diaper riotslatimer
25 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Soros is Attempting to Sink His Claws Into America's 2nd Largest Radio Network; The GOP Platform goes Anti-Globalist
#yuval noah harariukraine conflictthe anti globalist manifesto9 11anti globalismaudacydeep state conspiracydonald trumpeagle forumeconomic collapseed martinfccgeorge soroshomo deusjoe bidenjulian assangemark levinmedia censorshipphyllis schlaflyrncrobert f kennedy jrsean hannitysteve bannonswiss america
24 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Snopes Finally Acknowledges 'Very Fine People' Hoax -- But Why Now?
#yuval noah hararitranshumanismsnopesbureau of labor statisticscharlottesvillechicago homelessnessclaudine gaydegrowth communismdiversity equity inclusiondonald trumpfact checking integrityfinal sparksharvard universityhomelessness crisisjoe bidenkohei saitolabor statisticsmarx in the anthropocenemit
21 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #WHO to Enforce New Pandemic #Censorship Rules; Archbishop Vigano Challenges Pope, Vat II
#zelenskyworld health organizationworld economic forumarchbishop carlo maria viganobeasts markcatholic churchciaconspiracy theoriesglobal governancejohn f kennedylee harvey oswaldmilitary industrial complexmrna spike proteinspolitical corruptionpope francissecond vatican councilsynodal processukraine warvaccine mandateswestern sanctions
20 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Newsom's Crime-Friendly California; The Biden Admin's 'Cheap Fake' Lies
#vladimir putinpresidential competenceoakland violenceanti globalist allianceconspiracy theoriescultural backlashdonald trumpeconomic instabilityequus pollgeopolitical alliancesglobal crashhsbc money launderingimmigration policyjfk assassinationjoe bidenjoy reidkim jong unlee harvey oswald
19 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What Really Happened at the Hunter Biden Trial From Someone Who Was There - with Mike McCormick
#wilmington delawarevictoria nulandpolitical corruptionbarack obamabribery allegationsburismaconspiracy theoriesdavid weisseric holderhunter bidenhunter biden trialjake sullivanjeffrey pyattjerome corsijoe bidenmedia censorshipmetabiotamike mccormick
18 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why is there an Algorithm in the New York State Board of Elections Voter Roll and WHO Put it there? with Andrew Paquette
#voter fraudsteganographyrep units338000 illegal registrationsaid numbersalgorithmic analysisallegheny countyandrew paquettecaesar cipherdata manipulationelection integrityjerome corsimail in ballotsmp voter casenew york state board of electionsnyca
17 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden Freezes On Stage: Is the End of His Re-Election Campaign Nigh?
#world war iiiworld economic forumreligious fundamentalismbenjamin netanyahuclimate change denialclub of romeconspiracy theoriesdeep stategavin newsomgeopolitical conflicthenry kissingerjack rubyjerome corsijfk assassinationjoe bidenjulian assangekamala harrisnatopolitical corruption
14 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Behind the Biden-Ukraine Political Theater; Biden Gets Cranky When Asked Off-Script Question
#vladimir zelenskyukraine wartranshumanism2 chronicles 7 14clinton foundationdeep statedeep state conspiracydr jerome corsidr john corsieconomic inflationg7 summitjeffrey epsteinjoe bidennoah hararipresidential dementiaspiritual warfarethe truth central
13 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden Overstates Jobs, Bumbles Way Into G7 Meetings
#ukraine warsteve bannonpolitical persecutionarchbishop viganochinese electric vehiclesdeep stateeconomic declinefederal reserve policyg7 meetinggeopolitical conflictgiorgia melonihezbollahhouthi missile attacksisrael gaza conflictjoe bidenmedia censorshipmerrick garlandnancy pelosipetrodollar
12 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Deeper Look into the Hunter Biden Conviction and a Tribute to Tony Lo Bianco
#world economic forumtony lo biancothe shroud codexanti globalist allianceconspiracy theoriesdeep statedeep state conspiracydr faucieconomic collapseeuropean central bankf 16hunter bidenhunter biden convictionjoe bidenjohn f kennedyjohn f kennedy assassinationlee harvey oswaldmrna vaccinesrussia ukraine war
11 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
EU Voters Take Down Globalists, Climate Alarmists; Why the World Let's Iran Destroy the Middle East
#the anti globalist alliance manifestosudan starvationreligious worldviewchina russia conflictconspiracy theoriesdepopulation agendadr mantikgetrxmedsnowglobal conflictgreen partieshamashezbollahiranjerome corsijoe bidenkamala harrislee harvey oswaldmiddle east warpolitical polarizationpresidential health
10 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the CCP's Bioweapons Research and Measures Taken to Hide it with Dr. Li-Meng Yan
#zxc21 viruszc45 viruswuhan lab leakamerica out loud talk radio networkbioweapon theorychinese communist partycovid 19 origindr jerome corsidr li meng yangain of function researchgeneral wang wenquanpeoples liberation armypeter daszakralph baricthe truth centraluniversity of hong kongwho disinformationwuhan international airport
07 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden Administration’s Latest Political Stunt Targets Steve Bannon
#world war iiiukraine russia wartranshumanismbiden administrationbill gateschina pakistan relationsdavid mattisdonald trumpeconomic recessionjanuary 6th committeejerome corsijulian assangekaja kallaskharkovkievlawfarenational debtsaudi arabiasteve bannonswiss america
06 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What will Really Come Out of the Hunter Biden Show Trial?
#zero emission vehiclesrosemont senecaroe v wadebohai llcdemocratic party corruptiondepartment of justicedonald trumpeconomic declineglobalist plotshunter bidenhunter biden prosecutionjames bidenjerome corsijfk assassinationkevin mccarthymike johnsonneo marxism
05 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pleiotropic Medicine and Hyperbaric Research: The Future of Health Care
#tony faucipatrick bouvier kennedymercury bulletbig pharma suppressionbobby koskadeep state conspiracydr edward fogartydr jerome corsidr manticdr paul harcheden carlsongetlongevitymedscomglutathionehyperbaric oxygen therapyivermectinjfk assassinationlong covid treatment
04 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions with Brian Sussman, Author of #ClimateCult
#steven novellarachel carsonmilgram experimentaocbrian sussmanclimate changeclimate cultclimategatedan rathereco tyrannyenvironmental movementfrederick engelsgreen energyjerome corsimarxist ideologymass formationmichael mann
03 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump‘s Conviction: A Financial and Polling Boon for the Former President
#world economic forumukrainerudy giulianiallen dullesbigcruisecentralconspiracy theoriesdeep statedonald trumpemmanuel macronforeign policyhamasjohn f kennedylee harvey oswaldnaturepolitical corruptionprescott bushreligious freedom
2024 - May (22)
31 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Convicted in Stalinesque Show Trial: Did the Left Just Hand Him the 2024 Election?
#vladimir putinukraine warthe anti globalist alliance manifestoalan dershowitzalvin braggbostondeep statedeep state conspiracydonald trumpdonald trump convictioneconomic declinegeorge sorosjerome corsijoe bidenmichelle wunatoreligious fundamentalism
30 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Dems' Desperate Need for a Lawfare Win; The World Debt Crisis is Worse Than You Think
#zero hedgeurban declineukraine warandrew baileyanti globalist alliancederivativesdonald trumpeconomic collapsegeorge sorosglobal debt crisisgold rushisrael gaza conflictjoe bidenjudge meehanlawfaresaudi arabia
29 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DeNiro's Meltdown and the Desperation of the Biden-Harris Campaign
#warren commissionthe truth centralsaul alinskybiden harris campaigncamp cupcakeclimate change denialconspiracy theoriesdeep statedonald trumpgeorge sorosglobal economic collapsehunter bidenjanuary 6th insurrectionjerome corsijfk assassinationjoe bidenrobert de niro
28 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Israel-Hamas Political Conundrum; Dems Pin Hopes on Trump Hush Money Trial
#zelenskynuclear war risknsaciaclimate change policydeep statedeep state conspiracydonald trumpgold rushisrael hamas conflictjerome corsijfk assassinationjoe bidenlawfare strategyneo nazinet zero goals
24 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Big Bronx Trump Rally Worries Dems; Putin Wants a Ceasefire in Ukraine?
#zelenskyvictoria nulandukraine waranthony blinkenanti globalist alliancedeep statedei programsdonald trumpeconomic collapsefbi raidgender identityjerome corsijfk assassinationlee harvey oswaldmar a lagoputinsarah netburntrump administration
23 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Behind the Biden Administration's Authorization of Use of Deadly Force for Trump Home Raid
#vaccine safetysupreme courtrobert kennedy jrbiden administrationbill gatesbreonna taylordeep state conspiracydonald trumpdr manticeconomic collapseedward fogartyjerome corsijfk assassinationlee harvey oswaldlipid nanoparticlesmar a lagonoah hararinuclear warpfizerreligious freedom
22 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Untold Stories of Ashli Babbitt and the Women of January 6th with Jack Cashill
#world economic forumroseanne boylanray eppsantifaantifa activismashley babbittblack lives matterbrian sicknickconspiracy theoriesdonald trumpgeorge floydgovernment cover upjack cashilljanuary 6th insurrectionjerome corsilila morrismarxist revolutionmichael byrdnew world orderpolitical polarization
21 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Families Can Not Keep Up with Biden's Inflation; How Lawfare Against Trump Made the Former President a Hero
#transgender rightssupreme courtnetanyahu14th amendmentbill gatesdeep state conspiracydonald trumpebrahim raisiglobal financial crisisgold investinghamasinternational criminal courtjanuary 6th insurrectionjerome corsijfk assassinationjoe bidenklaus schwablawfare prosecutionslgbtq agenda
20 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Worldwide Embalmers Survey Exposes White Fibrous Clots a deadly COVID Vaccine Side Effect: with Fmr. USAF Maj Tom Haviland
#white fibrous clotsvaccine clotssv40 viral sequencesadverse eventsamyloid proteinscleveland clinic studydepopulation theoriesdied suddenlydr jerome corsidr tom havilandhydroxychloroquineivermectinmrna vaccine safetypublic health englandpublic health policyremdesivirspike protein
17 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Lunacy of World Government, the WHO Pandemic Power Grab and Marxist DEI
#world health organizationwoke ideologytedros adhanom ghebreyesusanti globalist alliance manifestobill gatesclimate change denialconspiracy theoriesfinancial collapseglobal health governancejasmine crockettjerome corsiklaus schwablee harvey oswaldmarjorie taylor greenemarxist educationmichael cohensilent no moresteele dossier
16 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The West Using War to Finance Debts? Biden vs. Trump is On -- With Biden Camp Restrictions
#warren commissionvolodymyr zelenskyukraine conflictcyril weckdeep state conspiracydonald trumpgeorge soroshamasiranisrael hamas warjerome corsijfk assassinationjoe bidenlee harvey oswaldmartin armstrongmichelle obamanew world orderpresidential debatesrobert kennedy jr
15 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth Behind the Fudged U.S. Crime Numbers; Ukraine Defenses Are Overrun, So What's Next?
#world war iiiwoke intoleranceukraine warafdb61 gravity bombsbill gatesclarence thomasconspiracy theoriesdeep stateeconomic collapsefree speechgeorge soroshamasislamic jihadisrael hamas conflictjack kennedylee harvey oswaldmrna vaccinesnatopolitical corruptionsamuel alito
14 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why America's Middle Class has Reached its Breaking Point
#war room bookstransgender rightstides foundationbiden administrationeconomic declineepageorge sorosglobal politicshezbollahhouthi rebelsiran revolutionary guardisrael gaza conflictjfk assassinationlee harvey oswaldopen society foundationrichard nixonsteve bannon
13 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Defending Religious Freedom in the U.S. with Chaplain Gordon (Dr. Chaps) Klingenschmitt
#transgender issuesreligious freedomnavy chaplain policyabortion rightschristian persecutiondonald c winteremtala laweva edelgordon klingenschmittgovernment overreachirs scrutinyjerome corsejohn warnerlawfaremanipur
10 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Economic Fantasy World; Why the War on Israel is a War on the West
#woke insanityvladimir putinukraine conflictbric nationsciacultural maoismcultural marxismdeep statedonald trumpeconomic collapseiranisrael hamas warjerome corsijoe bidenmedia manipulationnatothe anti globalist alliance manifesto
09 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
#BRICS Salivates Over Dollar's Demise; Russia Attacks #Ukraine Power Grid as #NATO Expands the War
#woke ideologyukraine warthe truth centralbricsciadeep state conspiracydr jerome corsidr manticgeorge sorosglobal financial crisishamashunter bidenjfk assassinationjfk autopsyjoe bidenmilitary industrial complexnato expansion
08 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Mishandling of Evidence Bombshell Postpones #Trump Docs Case; Why Ukraine War Funding is Far From Over
#who really killed kennedyukraine wartesla2 chronicles 7 14conspiracy theoriesdeep stateeconomic collapseelon muskforeign policyhamasiranjack smithjerome corsipolitical corruptionreligious fundamentalismrobert kennedy jrswiss america
07 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden Administration’s #Economic Mentality and Modern Monetary Theory; #Israel Poised to Take #Rafah
#yasser arafatstudent protestsnew world orderayatollah khomeinibeattruthcentralbill gatescolumbia universityconspiracy theoriescouncil of economic advisorseconomic collapsehamasjared bernsteinjerome corsijfk assassinationjoe bidenklaus schwabmodern monetary theorymuslim brotherhoodneo marxism
06 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Case to Impeach and Imprison #Biden from an Eyewitness, His former Stenographer
#wuhan virus conspiracywuhan virusviktor zlobenkobiden corruptionburismaburisma scandalcia allegationsdonald trumphouse oversight committeehunter bidenjfk assassinationjoe bidenmedia censorshipmetabiotamike mccormickmike pompeothe case to impeach and in prison
03 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the College Pro-Hamas #Protests; #Avenatti Comes Clean About #Trump Shakedown
#world economic forumwar room bookstruth centralanti globalist alliance manifestobill gatesbrown brothers harrimanclimate change denialconspiracy theoriesdulles brothersglobal elitejerome corsijfk assassinationklaus schwabmike pompeonew world ordernew york timesprescott bushsteve bannontranshumanism
02 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hamas is Playing the US, West as Fools; Will the Dems Orchestrate a 1968 Redux?
#us electionsukraine warnatoanti globalist alliance manifestoatacms missilesbannons war roombassam tawilciaconspiracy theoriescuban missile crisisdeep statefrom the river to the seagetrxmedsnowhubert humphreyisrael hamas conflictjerome corsijohn f kennedylee harvey oswaldmilitary industrial complex
01 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Campus #Protests Are Getting Worse; #NATO Prepares for Face-Off with #Putin
#yanukovychukraine conflictukraineanti globalist allianceanti semitismburismaconspiracy theoriesfederal reservegeorge sorosglobal economic crisishamashunter bidenisrael hamas warjerome corsijohn f kennedynatonato military exercisesrussiastudent proteststruthcentral
2024 - April (22)
30 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
While Biden's Gaffes Crack Us Up, The Counter-State is Destroying America
#the final analysisroe v wademartin luther king jrbiden administrationclimate changeconspiracy theoriesdeep stateforeign policygender ideologygeorge sorosgrassy knollgreen new dealjerome corsijohn f kennedylee harvey oswald
29 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
U.S. Colleges Are Grooming Terrorists; Why #NATO Continues to Artificially Prop up #Ukraine?
#zelenskyukraine warthe final analysisciadeep state conspiracyeconomic collapsegeorge soroshamashunter bidenjerome corsijfk assassinationjoe bidenlee harvey oswaldmaidan coupmiddle east conflictmilitary industrial complexnatorussia
26 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Alvin Bragg Embarrassment Worsens; Has the Deep State Become a Counter-State?
#ukrainethetruthcentraltaiwanalvin braggbiden administrationclimate policydeep statedonald trumpeconomic collapseepaforeign aidharvey weinsteinisraeljerome corsijpmorganlawfarenatonew york timesreligious moralityshugerman
25 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What's Behind the Anti-Semitism, Pro-Hamas Protests on U.S. College Campuses?
#political corruptionmetalee harvey oswaldassassination plotsatacms missilesbarack obamabird fluconspiracy theoriescultural marxismdeep statedonald trumpeconomic collapsegrassy knollhamasjack kennedyjoe biden
24 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvatican iitrump impeachmentarchbishop viganobruce ohrchristopher steelecoup detatdeep state conspiracydoug hornjfk assassinationjohn corsijohn mccainmi6michael isikoffmueller investigationnew world orderseth richsteele dossierthe final analysis
23 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Which Radical Democrat City Will Crumble First? What's Behind #NATO's Thirst for Wars
#ukrainesocial collapsepro hamas protestersantisemitismarchbishop carlo maria viganociaclimate emergencycolumbia universityconspiracy theoriesdonald trumpdulles brothersforeign policyfrom the river to the seagreen new dealjohn f kennedylawfaremalthusian ideasmichael snydernatopolitical corruption
22 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Jamie Dimon's Warning to the #FederalReserve; #Ukraine Gets Big Bucks as Johnson Caves
#william burnswells fargovolodymyr zelenskyarchbishop viganocitigroupconspiracy theorieseconomic crisisiranisraelisrael iran conflictjamie dimonjerome corsijohn f kennedyneo marxismproject aquareligious extremismseymour hershukraine war
19 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive
#vietnam warthe final analysissecret service9 11ciaconspiracy theoriesdealey plazadeep statedr jerome corsidr malcolm perryford motor companygeorge whitaker srgulf of tonkinjfk assassinationjohn f kennedymilitary industrial complexnational archivesreligious themes
18 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Unbiased Jurors Scarce for #Trump Trial; Dems Desperate #Election2024 Strategy
#religious fundamentalismpolitical persecutionnew york hush money trialciaconspiracy theoriescultural marxismdonald trumpeconomic collapsefrankfurt schoolgold pricesgooglehamashillary clintonjerome corsijoe bidenjohn f kennedylee harvey oswald
17 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will Israel Attack Iran? The Spying Power-Up Hidden in the FISA Re-Authorization
#world war iiithetruthcentralopen bordersbiden administrationcultural revolutiondavid camerondonald trumpeconomic collapseeuropean court of human rightsfisa reauthorizationgovernment surveillanceiranisraelisrael iran warjerome corsilawfaremahdinsa
16 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About the #JFK Assassination: The Medical Cover-Up
#thomas boswelltexas school book depositorysecret serviceautopsy forensicsbethesda pathologistsciaconspiracy theoriesdeep statedr david manticdr jerome corsigovernment deceptionjames humesjfk assassinationjohn f kennedylee harvey oswaldmilitary industrial complexparkland hospital
15 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Makes History with the Hush Money Trial as Jury Selection Begins
#woke ideologiestransgender rightsreligious revivalbidenomicsciaconspiracy theoriesdeep statedonald trumpeconomic collapsehamasiran israel warjerome corsijoe bidenjohn f kennedylee harvey oswaldmiddle east conflictpolitical corruption
12 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Gold is On the Rise in 2024 with Dean Heskin, CEO of Swiss America
#us debt crisisswiss americasan francisco1970s oil crisisbank of americabricsbullion barscbdccentral bank digital currenciescommercial real estatedean heskinde dollarizationdr jerome corsigold investmentponzi scheme
11 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Over 3 Years of #Bidenomics: What the Media Doesn't Want You to Know; Iran Preps to Attack Israel
#the final analysisprescott bushnatobiden administrationblackrockciadavid manticdeep statedeep state conspiracyesg fundsesg investment crisisgreen energyiran israel warisrael iran conflictjerome corsijfk assassinationjfk skull x raysjohn foster dullesmercury bullets
10 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Let's New Stealth Mail-In Ballot Plan; Biden's Attempts to Buy the Gen Z Vote
#world economic forumwoke ideologyvoter frauddetroiteconomic crisisgaza wargovernment overreachjerome corsijfk assassinationjoe bidenjohn f kennedymodern monetary theoryst louissupreme courtthetruthcentralus marshals
09 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Jamie Dimon's Dire Warning to the World; Is the EU Falling Apart Over NetZero, Russia?
#ukraine wartransgender rightstaiwan conflictclimate change skepticismconspiracy theoriesdonald trumpeconomic collapsegovernment overreachisrael hamas warjamie dimonjohn f kennedylee harvey oswaldmark moranomilitary industrial complexnet zero
08 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Where America is Now and a Message of Hope for Our Country with Gen. Mike Flynn
#weapons of mass destructionunipartymichael flynncolin powellconspiracy theoriesfifth generation warfareflynn deliver the truthgovernment deceptiongulf of tonkinhsbcjerome corsijfk assassinationjulian assangelee harvey oswaldmedia censorship
05 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The WEF's War on Farmers and a Mainstream Journalism Extinction Event
#washington poststeve bannonroe v wadeagenda 2030anti globalist alliancebiden administrationbill gatesconspiracy theorieseconomic policygeopolitical conflictisrael hamas warjohn f kennedyjohn kerrymark victor hansenmedia censorshipnew york timesonyx dr jerome corsepolitical polarizationreligious fundamentalism
04 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Deep State Comes After Trump's, Musk's Assets; Is NATO on the Verge of Breaking Up?
#warren commissiontransgender day of visibilitynato crisis14th amendmentaisha siddiqaclimate change denialconspiracy theoriesdeep statedonald trumpeconomic collapseelon muskface lawfrankfurt schoolgoldjerome corsijfk assassinationjoe bidenjohn f kennedynato
03 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Focusing in on Screenshots and Witness Accounts of #JFK's Assassination and Evidence of the Massive Coverup
#woke neo marxistswarren commissionukraine warciaconspiracy theoriesdavid manticgovernment cover upgrassy knolljerome corsijfk assassinationjohn f kennedylee harvey oswaldmichael chesternational archivesnato expansionnicholas katzenbachpolitical polarizationreligious extremismthetruthcentralcom
02 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Prison Terms for Hate Speech? California's $1.6 Trillion Debt
#woke ideologyukraine conflictneo marxismcalifornia debtciaclimate change denialconspiracy theoriesdeep stateelectric vehicleshavana syndromeisisjerome corsijoe bidenjohn fitzgerald kennedylee harvey oswaldlgbt rightsnato
01 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Prominent Archbishop Calls for Joe Biden's Excommunication from Catholic Church
#trans visibility daythe truth centralreligious extremismalphonse louis constantanti globalist allianceassassination plotsbaphometbethesda naval hospitalcarlo maria viganòconspiracy theorieseconomic collapsefrankfurt schoolherbert marcusejoan corsijoe bidenjohn f kennedylee harvey oswaldparkland hospitalpolitical corruption
2024 - March (21)
29 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Woke Be Damned: Bring Back Science with John Droz, Jr
#scientific methodnorth carolina primaryngss2020 electionaaprjohncritical thinkingeducation reformelection integrityethanol mandatesframework for science educationgovernment mandatesjoel korsijohn droz jrmichigan auditnevada auditnew york auditnext generation science standards
28 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Debt Market Meltdown Coming; The Baltimore Bridge Collapse May Cost Billions
#world economic forumswiss americapolitical polarization9 11bay of pigsciaconspiracy theoriesdonald trumpdr jerome corsieconomic collapsefdrfrancis scott key bridgegold standardgovernment corruptionjfk assassinationjohn f kennedylee harvey oswaldmodern monetary theorymoscow attacknewt gingrich
27 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Questions Raised About the Baltimore Bridge Collapse; The Men Behind JFK's Assassination
#world war iiiwall streetnational archivesconspiracy theoriesdavid mantikadeep statedonald trumpdulles brothersfrancis scott key bridgeglobal new world ordergreat replacementjerome corsijfk assassinationjoe bidenjohn f kennedylee harvey oswaldmichael flynn
26 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
#Baltimore in Disarray After Key #BridgeCollapse; US-#Israel Relations Deteriorating After UNSC Gaza Vote
#world war iiiukraine conflictreligious fundamentalismbenjamin netanyahubiden administrationclimate change denialconspiracy theoriescrime and punishmentdefund the policeforeign policyfrancis scott key bridgegreen energy agendaipccisrael hamas warjerome corsijohn f kennedypolitical corruptionpost modernism
25 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Excessive Money-Printing: The Fuel of Our Current World Chaos
#unrwaunited airlinesthe final analysisbethesda naval hospitalbric nationsciacultural wardavid manticdeep state conspiracydepartment of justiceeconomic collapseglobal governancehouthi attackshunter bidenjerome corsijfk assassinationlee harvey oswaldparkland hospitalscott kirby
22 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did the CIA Block the House from Interviewing Key Hunter Biden Associate?
#the final analysistexas school book depositorypatrick kevin morrisallen dullescia corruptionclimate change hoaxconspiracy theoriesdavid manticdr jerome corsieconomic collapseglobalismharper fragmenthsbchunter biden investigationjack rubyjohn f kennedy assassinationlee harvey oswaldnew world order
21 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Impeachment Inquiry Exposed 'Big Guy' #Biden; A Primer on New 'News-Speak' Gaslighting
#truth centralroe v wadejoe bidenbiden impeachmentchinese communist partyclimate change policycultural decaydefense department reporteconomic declineeuropean climate changehunter bidenillinois healthcarejerome corsijfk assassinationjim jordan
20 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Supreme Court Hands Texas Big Border Win; Will a #Biden Impeachment Actually Happen?
#ukraine warpeter navarropentagonamazonanthropocene epochciaclimate changedavid manticgooglegrassy knollgreat replacement theoryhunter bidenjanuary 6th committeejerome corsijfk assassinationjoe bidenlee harvey oswaldmicrosoftnew york times
19 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putin's Warns of World War 3 if NATO Sends Troops to Ukraine; Trump Prosecutor in a Legal Conundrum
#warren commissionvladimir putinukraine war9 11conspiracy theoriescultural conservatismdeep statedonald trump trialeconomic crisisjack smithjerome corsijfk assassinationjoe bidenjudge eileen cannonkamala harrislee harvey oswaldnatopresidential records actthe final analysis
18 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Texas Could Truly Secure the Border; Biden Doubles Down on Net Zero Rules
#the final analysisterrablock barrierslee harvey oswaldassassination plotsbiden administrationblack swan eventscarlo maria viganòciaconspiracy theoriesdepartment of justiceeconomic collapseelon muskfbiglobalismgovernment corruptionjerome corsijohn f kennedy
15 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Schumer Demands New Israel Election; Toronto Police Honcho Says 'Make Car Thefts More Convenient'
#yuval hararithe truth about energythe final analysisabortion rightsbenjamin netanyahuchuck schumerelectric vehiclesglobal warminggold investmenthamasisrael gaza conflictjerome corsijfk assassinationjohn f kennedyklaus schwablee harvey oswaldmalcolm perryrafahricciardi
14 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Fani Willis' Loses Again; Putin Sending Troops to Finland Border; Credit Card Delinquencies Rise
#wallethubswedenrussiabiden administrationclimate changedonald trumpdr david manticdr jerome corsieconomic declinefani willisfinlandgeorge sorosgovernment conspiracyjfk assassinationjohn f kennedylee harvey oswaldmedia censorshipnatonato expansionnet zero goals
13 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Takeaways from the Robert Hur Testimony; The Movement to Ban Tik Tok Pushes Forward
#warren commissiontiktok banthetruthcentralcomadam schiffbill gatesconspiracy theoriesdavid manticdr jerome corsigovernment cover upjfk assassinationjoe bidenjohn f kennedykamala harrismedia manipulationmitch mcconnellnato expansionpolitical corruptionrobert hur
12 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
What Forensic Research Reveals About JFK's Assassination and What the Government Tried to Hide
#the final analysisparkland hospitalnew york timesbethesda naval hospitalciaconspiracy theoriesdavid vantekdr jerome corsifox newsgovernment cover uphistorical revisionismjfk assassinationjohn f kennedylee harvey oswaldlyndon johnsonmedia censorshipnational archives
11 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are France and the UK Sowing the Seeds for War? Shocking New JFK Assassination Revelations
#nuclear warlee harvey oswaldklaus schwabalan dawesbill gatesciaconspiracy theoriescritical race theorycuban missile crisiscultural marxismdavid manticgeorge sorosglobal resetgreat resetjerome corsijfk assassination
08 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Persecuted for Exposing Potential COVID Vaccine Dangers: Dr. Charles Hoffe's Story
#vaccine safetypierre khourypeter mccullochastrazeneca vaccinebill 36college of physicians and surgeons of british columbiacovid 19d dimer testsdr bonnie henrydr charles hoffgivesendgogovernment overreachhealthcare accessivermectinivermectin controversyjustice centre for constitutional freedomslipid nanocapsulesmedical censorship
07 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Where Woke Came From and Where it's Going pt 8: Hegel, Boehme and Pseudo-Reality
#victoria nulandukraine conflictsuper tuesdayantony blinkenarchbishop viganobill gateschicagocommercial real estate crisisconsumer debtcritical race theorydarien gapelaine chaofani willisfederal reservefiat money collapsegeorge sorosglobal conspiracy theoriesgold priceshouthi attacksjerome corsilondon breedmitch mcconnellnikki haleyopen border policiesron paul
06 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth About Weaponized Migration; How the Fed is Responsible for the U.S. Debt Crises
#victoria nulandron paulpolitical corruptionarchbishop viganobiden administrationchicago gang violenceeconomic collapseelaine chaofederal reservegeorge sorosgold investmenthouthisjerome corsimitch mcconnellopen border policies
05 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
EU Shifts to War Mode; Dems Melt Down over Trump SCOTUS Win, Wall Streat Runs from DEI
#supreme court rulingrussia ukraine conflictred seabill gatesclimate change policydiversity equity and inclusiondonald trumpeconomic collapseenvironmental social and governancegazageorge sorosglobal trade disruptionhillary clintonhouthi missile strikeiranisrael hamas warjoe bidenklaus schwablebanonmaidan revolutionmarxist agenda
04 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Germany's Plot to Destroy the Crimea Bridge; Inside Putin's Warning to NATO
#vladimir putinukraine warthe truth centralbarack obamacarlo maria viganòclimate geoengineeringcrimea bridgecritical race theorydonald trumpeconomic crisisemmanuel macronfederal reservejoel corsinato interventionneo marxismnew world ordersolar radiation managementtaurus cruise missiles
01 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pentagon Warns of War with Russia if Ukraine Falls; Obama Tries to Spy on Trump Again
#ukraine conflictukrainetrump campaignciaclimate changecoup detatdeidemocratic corruptiongender identityjerome corsikathy hochullloyd austinmike johnsonnatonato russia warneo marxismobamapentagonrobert shermanrussia
2024 - February (22)
29 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Don't Be Fooled by Fake Bidenomics 'Growth,' World War Worries and Apple's EV Plan Fails
#world economic forumvladimir putinukrainearchbishop viganoeconomic declinefederal reservegeorge sorosglobalist conspiracygreen energy failurehunter bidenhunter biden testimonyjerome corsijoe bidenjoe biden healthjonathan leemodern monetary theorynatonato expansionrussian oligarchstucker carlson
28 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Butterfly Effect, Junk Science, Critical Theory and Woke Gaslighting
#world economic forumthetruthcentralmarxist cultural revolutionbezvinovbill gatesbutterfly effectcarbon dioxidecarlo maria viganòclimate changeclimate change denialconspiracy theoriescritical race theorydemocratic partyeconomic collapseedward lorenzgender identity politicsgeorge sorosjerome corsijoe bidenjudith butlerklaus schwab
27 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putin's New Nuclear Threat, Biden Admin Underestimates the Houthis, More Fani Follies
#ukraine conflictukrainereligious conservatismbiden administrationdonald trumpeconomic collapsefani willishezbollahhouthisiranjanuary 6thjeff desantisjens stoltenbergjerome corsimiddle east warnatonuclear warpolitical corruptionputinrafael grossi
26 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Spy Wars, Middle Class Malaise and Banks Dropping ESG
#war euro bondsvladimir putinukrainian intelligence officersciaclimate action 100dmitry medvedevdonald trumpeconomic declinefederal reserve policyjerome corsimaidan rebellionnewt gingrichnew york timesnuclear escalationreligious rhetoricstate departmentthetruthcentralcomtom lungoukraine conflict
23 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Declaration of North America, WHO Pandemic Treaty and the Medical Martial Law Plan
#yuval noah harariworld health organizationmyriad geneticsagenda 21bill gatesbureau of justiceconspiracy theoriescrispr cas9donald rumsfeldgenetic modificationglobal health governancehuman rights abusesjerome corsiklaus schwabmedical martial lawmrna vaccines
22 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hard Truths About Ukraine Surface as Russia Takes Avdeevka
#woke ideologiesukraine wartranshumanismavdiivkabiden administrationciadepartment of justicedonald trumpdonetskdr jerome corsieconomic declineglobalist agendamike pencenatonet zero policiesnuclear war riskpaul ryanrussia ukraine conflictthetruthcentralcom
21 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Agenda 2030 Totalitarian Time Bomb; Israel Maps Out Rafah Offensive
#ukraine warukrainetransgender rightsagenda 2030antony blinkenbarbara jonesclimate change denialdmitry medvedevdonald trumpdr jerome corsiglobal economic collapsehamashunter bidenisrael hamas warjulian assangenational christian broadcastersnatonato expansionrafahrussia
20 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Medvedev's Dire Warning; Public Education's Propaganda Mills
#world war iiiwoke ideologyukraineb61 12 nuclear warheadscook county decarcerationcriminal justicedmitry medvedeveducation reformgatestone institutegeopoliticsgeorge soroshamasjerome corsimaidan uprisingmedia censorshipnatonuclear warraf lakenheathreligious persecution
19 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Climate Gaslighting Hits New Low; Will There Be a Post-Trump Verdict NY Boycott?
#wayne allyn rootukraine wartransgender military service2 chronicles 7 14alex sorosclimate change denialcritical race theorydei programsdr jerome corsiglobalist conspiracykelly wongneo marxismnuclear warpentagonrachel levineroland fryer
16 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Deeper Look at the WHO Power Grab Treaty: Unconstitutional and Potentially Devastating
#world health organizationworld economic forumwho treatycdcchinese communist partyconstitutional lawdigital idfdaglobalismhhshydroxychloroquineivermectinnational securitynihpublic health policyrodney howard brownsocial credit systemtedros ghebreyesus
15 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's 'Big Green' Giveaway; Gaslighting Over Russian Nukes
#world economic forumukrainepresidential dementiaburismademocratic party corruptionfani willisgreat resethunter bideninflation reduction actirsisrael hamas warjerome corsijoe bidenmedicarenatonato expansionnoah harari
14 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Mayorkas Impeached; Climate Reparations Craziness and the Diversity Training Disaster
#world economic forumtucker carlsontranshumanismalejandro mayorkasarchbishop viganobill gatescentral bank digital currencyclimate change denialdavid haskelldeep state conspiracydei trainingeconomic declineelon muskimmigration policyjerome corsijoe bidenreligious fundamentalismtom suozzi
13 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden Admin's Rage-Filled Border Feud; WHO's Power Grab Needs to Be Stopped
#xavier becerraworld health organizationvladimir putinalejandro mayorkasbill gatesclimate change conspiracydeep state theorydemocratic party crisiselon muskjerome corsijoe bidenneuralinkpresidential dementiarand paulreligious freedom lawfaresatanic templesusan ricetedrostranshumanism
12 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Biden Has Opened the Door to a Global War'; U.S. Household Debt Tops $17.5 Trillion
#world war iiiworld economic forumukrainechinaclimate changecultural criticismeconomic collapseforeign policygazahillary clintonhunter bideniranjake sullivanjerome corsijoe bidenmitch mcconnellnancy pelosipolitical corruptionrussia
09 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Decoding the Tucker Carlson-Vladimir Putin Interview - a Special Presentation
#world economic forumvladimir putinvictoria nulandbill gatesconspiracy theoriescuban missile crisisdmitry medvedevdr jerome corsigeorge sorosjoe bidenjohn f kennedykamala harrisneo marxismnikita khrushchevnuclear warpatrick sanderspolitical corruptiontucker carlsonukraine conflict
09 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside the World Health Organization's Dangerous and Aggressive Power Grab with Dr. Kat Lindley
#world health organizationwho authoritysocial credit scorearticle 18article 44biden administrationcentral bank digital currenciesdepartment of health and human servicesdigital vaccine passportsgain of function researchglobal governancejohn kerrynational sovereigntynew hampshire hb 1156one healthpandemic treatypublic health emergencypublic health emergency of international concern
08 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Supreme Court Hears Trump Ballot Case Arguments; Ford's EV Gamble a Huge Loss
#yuval noah harariworld economic forumtucker carlson14th amendment eligibilitybonnie manchestercarlo maria viganòclimate change agendadmitry medvedevdonald trumpelectric vehicle marketford motor companyglobal coup détatjanuary 6 insurrectionlarry tribemichael snyderneo marxismportland drug decriminalizationross clarksection 3 of the 14th amendment
07 Feb
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left’s Tizzy Over a Carlson-Putin Interview Elevates; The Gov't is Funding Censorship Supergroups
#world economic forumvladimir putintucker carlsonai censorshipclimate change agendacouncil on foreign relationsgaza conflictglobalismhomelessness crisishouthi rebelsjoe bidennational science foundationnato expansionneo marxistssan francisco homelessness
06 Feb
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Don’t Fall for the Dems’ Growth Hoax; Another Lefty Meltdown Over Tucker Carlson
#vladimir putinukraine wartucker carlsonbarack obamaclimate changedeieconomic collapseelectric vehiclesgold investmentgreen new dealhenry kissingerjerome corsijoe bidenjohn kerrynato expansionneo marxismswiss america
05 Feb
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
An In-Depth Look at the Real Michelle Obama, Who May Be the Dems' 2024 Presidential Candidate
#when we all voteuniversity of chicago medical centertrayvon martin2024 electionbernadine dornbill ayersblack lives matterdr jerome corsifrank marshall davisgeorge soroshunter bidenjoe bidenjoel gilbertmedia narrativesmichelle obamapolitical allegationsrace relations
02 Feb
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Much Closer Are We to War with Iran? CA, NY May Soon Lead a Wave of State Bankruptcies
#world economic forumukraine conflictsubstackbiden administrationcameron campanella iichristopher wrayclinton foundationcloudhubcloward piven strategygreen energy policyhillary clintoniran nuclear programisrael hamas warjanuary 6 insurrectionjerome corsijohn kerryjohn podestapinochek
01 Feb
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Globalists Want CBDCs -- and Fast! ESG Investing is Down For the Count
#world economic forumsherry ann charlestonreligious extremismarrivalclimate change denialdei agendadonald trumpeconomic collapseesg investingeuropean farmers revoltgender identitygreen new dealjames okeefejamie dimonjohn podestajpmorgan
2024 - January (22)
31 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
National Hispanic Christian Leadership Conference (NHCLC) Brings Forth HablaConUnMD.com Spanish-Language Telemedicine
#woke ideologytrillotelemedicine accesscorstetdreamersgoogle cloud platformhabla con un mdhispanic healthcareimmigration policyjerome corsinational hispanic christian leadership conferencenhclcopen border policiesprophetic activismreligious libertyroberto albinosamuel rodriguez
30 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
WEF Overlords Want to Euthanize the West; Why Wokies Continue to Demonize Israel
#yuval noah harariworld economic forumtotalitarianismalejandro mayorkasbill gatesborder crisiscarlo viganoclimate change policyfalse flag operationsgatestone institutegeorge sorosgideon prinsgreat awakeninggreat resethamasjb schurkjerome corsiklaus schwab
29 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is the U.S. Already Kind of at War with Iran?
#woke marxismtransgender rightstom cottonarmy of godborder securityeconomic collapsegold and silveriran conflictiran nuclear programjanuary 6thjerome corsijoe bidenlindsey grahammitch mcconnellnet zero policiespoynter institutethe truth central
26 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Several Govs Back Abbott on Border Battle with Biden; Marxists Move to Brainwash Kindergarteners
#world economic forumreligious conspiracyneo marxismagenda 2030biden administrationborder crisiscarlo maria viganòcritical race theoryfrank marshall davisgen zglobal governancegreg abbottjack kawanolgbt identity
25 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Border Showdown: Texas vs DC; Political Showdown: Kari Lake vs. The Swamp
#world economic forumus immigration policytran tifaagenda 2030america for salebiden administrationchina economic crisisgender identity issuesglobalist conspiracy theoriesgovernment corruptionhouthi rebelsjeff dewittjerome corsikari lakenational guardtexas border crisis
24 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
WEF 'Agenda Contributor' Says Human Rights Are 'Fictional;' Takeaways from NH Primary
#yuval noah harariworld economic forumwoke culturecarbon 60climate change policydonald trumpelectric vehiclesfossil fuelsglobal economic crashhamashezbollahintersectionalityisrael hamas warjoe bidennew hampshire primarynikki haleyobama
23 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Disease X: The Globalists‘ New Weapon
#world health organizationworld economic forumunited airlinesbiden administrationblinkenchinese communist partydemocratic party criticismdisease xeconomic collapseglobalist conspiracyhamashenry kissingerhezbollahiranisrael hamas warjerome corsimarxist ideologynational security memorandum 200obama administrationthe truth central
22 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
DeSantis Drops Out; Haley Plays to Dems
#world economic forumukraine war analysisron desantisagenda 2030central bank digital currencyclimate change skepticismclinton foundationconspiracy theoriesdonald trumpelectric vehiclesmodern monetary theorynikki haleynikki haley criticismpetro poroshenkopresidential electionrobert kennedy jr
19 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Davos is Deflating -- As Are Lawfare vs. Trump and Democrat-Run Cities
#world health organizationworld economic forumvolodymyr zelenskybetruecentralcombiden administrationcritical race theorycultural maoismdavosdepopulation theorydr jerome corsigeorge soroshouthi rebelsnato expansionneo marxismopen borders debatepresident trumpred sea shippingreligious ethics
18 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Failing World Economic Forum: A Globe-Wide Subject of Ridicule
#world health organizationworld economic forumwalter russell meadconspiracy theoriesdepartment of justiceeconomic collapsegateway punditgender identityglobal governancegold standardhunter bidenjake sullivanklaus schwabnew world ordersurveillance statetucker carlsonwall street journal
17 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How the World Health Organization Can Force a Global Lockdown - with Dr. Kat Lindley
#yuval noah harariworld health organizationworld economic forumbiden administrationbill gatescentral bank digital currenciesdonald trumpeconomic crisisglobalist agendagovernment surveillanceinternational health regulationsjake sullivanjerome corsimilitary industrial complexnikki haleypandemic treatytedros adhanom ghebreyesustucker carlsonvivek ramaswamy
16 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Easily Takes Iowa; Cold Temps Spell Trouble for EVs
#world economic forumron desantispolitical polarizationclimate change denialdeidonald trumpeconomic collapseelection fraud claimselectric vehiclesesggold rushjerome corsijoe bidenjohn kerrymedia biasnew york timesnikki haley
15 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Lawfare Against Trump is Fizzling Out; NBC Admits 'Deep State' Exists
#world economic forumvictor davis hansonrisa nenealvin braggclaudine gaydeep state conspiracydiversity equity inclusiondonald trumpdonald trump legal caseseconomic crisisfannie willisiowa caucusesjack smithjerome corsijohns hopkinsletitia jamesmary mccordnathan wadepete buttigiegreligious fundamentalism
12 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exploring Climate Lies with Dr. Willie Soon
#urban heat island effectsteven chusolar variabilitycarbon dioxide emissionsceres scienceclimate change denialdr jerome corsidr willie soonintergovernmental panel on climate changeipccipcc criticismnoaaradiative forcingsolar output
11 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Fall of Destructive ESG & DEI Policies
#world health organizationvivek ramaswamyukraine warbiden administrationcarbon dioxide pipelinechris christieclimate changecritical gender theorycritical race theorydiversity equity and inclusionesgethanol mandatesgender identityglobalismhamasinternational conflictreligious valuessteve kingswitzerland
10 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bloated DEI Departments Jacking Up College Costs
#university of michigantruth centralneo marxismal bureji refugee campbiden administrationburismacritical race theorycultural maoismdei departmentseconomic declineelectric vehicle marketenvironmental movementesg initiativesgazahunter bidenhunter biden corruptionisrael hamas warisraeli defense forcesjerome corsi
09 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Archbishop Vigano Takes Down the Davos Agenda; Blinken Doubles Down on Two-State Solution
#world economic forumvictor davis hansontucker carlsonanthony blinkenbill gatescarlo maria viganocritical race theorycultural collapsedepopulation theoryenergy policygeorge sorosglobal conspiracyhamasiranjerome corsijoe bidenklaus schwabmiddle east conflictpope francis
08 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are Mass Layoffs Coming? The Left's NEW climate buzz-term: 'Climate Shadow'
#truthcentralspotifysound of freedomabortion rightsamazonclimate changeeconomic collapseeconomic collapse blogempire wind 2equinorgallanthasbrohouthiisrael hamas warjerome corsimaerskneo marxismnikeroe v waderussia ukraine conflict
05 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
2024: The Year to Cancel Wokeness
#woke ideologyklaus schwabjerome corsibeast limousinebill ackmanbill gatescarlo maria viganòclaudine gaycritical theorydei programselectric vehicleselise stefanikglobal depopulationgold investmentharvard universityiranisrael hamas war
04 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will 2024 be a Rough Year for the Globalists?
#woke communitysoleimanis tombreligious nationalism14th amendmentbill clintonclimate change debateepstein fileseugene debsfrankfurt schoolglobal debt crisisgold rushhamasinterglacial warmingjerome corsijoe bidenmarianne williamsonpolitical censorship
03 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will 2024 be the Year of Trump?
#world war iiiworld economic forumtransgender policies2024 electionbill gatesclaudine gaydei initiativesdonald trumpeconomic collapseel niñohamasharvard universityhezbollahjerome corsijoe bidenneo marxismreligious prophecythe truth central
02 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran, Houthis Ramp Up Red Sea Threats; Student Loan Borrowers Stage Debt Strike
#us national debtukrainesam bankman friedbiden familyclimate change denialcultural maoismdepartment of justicegazahamashouthi rebelsiranisrael hamas warjerome corsineo marxismpolitical corruptionred searussiarussia ukraine conflict
2023
2023 - December (16)
22 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dems Step Up Lawfare Against Trump; Look Who's Responsible for Most of the Carbon Emissions
#the truth centralseth richmatt gaetzblack lives matterblack votersclaudine gayconspiracy theoriescritical race theorydavid kopeliandonald trumpeconomic collapseepoch timesfrankfurt schoolgold rushhsbc investigationisrael hamas warjerome corsijulian assangemarketing of evilmark fisher
21 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Biden Admin Link to the Trump Ballot Ban; Wait - France is Handling Immigration Better than the US?
#world economic forumtransgender issuessocial media censorship14th amendment14th amendment eligibilityclimate change skepticismcoloradodonald trumpdr jerome corsielection integrityelon muskfrankfurt schoolhamashillary clintonhouthihunter bidenjoe bidenkolomoiskymarie le penmarxist ideologyroe v wade
20 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Twist in the Colorado Ballot Brawl
#woke agendaneo marxismmitch mcconnell14th amendment eligibilityarchibald cox jrbelt and road initiativebill gateschina us relationsclimate change denialcolorado primary ballotdonald trumpgeorge soroshamasisrael hamas warjanuary 6 insurrectionjudge melissa hartklaus schwabmagnequench
19 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Pentagon: A Multi-Trillion Dollar Financial Fraud?
#thetruthcentralpentagonnuclear energy policyben carsonbenjamin netanyahubiden administrationclimate change debateclinton foundationcop28department of energygazagovernment corruptionhamashouthi rebelshunter bideniranisrael hamas warjerome corsineo marxismnet zero
18 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside the Projected $97 Billion in Global Debt; The US Ukraine Aid-Border Showdown Continues
#ukraine wartruth centralneo marxism97 trillion debtbiden administrationclimate changeclinton foundationcop28critical race theorydemographic declinedepopulation plangaza conflictglobal debt crisishamashenry kissingerjerome corsi
15 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Politics of Androgyny: Where 'Woke' Came From - Part 8
#wilhelm reichubermenschthe truth centralbaphometcritical race theorydr jerome corsifrankfurt schoolfree speechgender identityhegelherbert marcusehermetic traditionjudith butlerkabbalahmarxismmax horkheimeroccult neo marxismone world governmenttheodor adorno
14 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Survey: 20% of Mail-In Voters Admit to Committing Fraud in 2020
#world economic forumthe truth centralsocialist economic policy2020 election fraudacademic freedombill gatesclaudine gayclimate change conspiracycop28dean prestondemocratic party critiquedonald trumpdr jerome corsifisa courtsharvard universityheartland instituterasmussen reports
13 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bad News for the Censorship-Industrial Complex
#world health organizationunukraine warbill gateschina economic influenceclimate change agendaclinton foundationcop28democratic party criticismelon muskfinancial system collapseglobal health governancehillary clintonhunter bidenjoe bidenklaus schwabmedia mattersnatoneo marxismpandemic accords
12 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Trouble for Harvard President; Zelenskyy's Latest Beg-A-Thon Commences
#world economic forumwarren buffettvolodymyr zelenskyybill gatesburismaclaudine gayclimate change policycritical race theoryeconomic declinehamasharvard universityhenry kissingerhunter bidenisrael hamas warmarxismmarxism in academiaoctober 7th attacksukraine conflictvladimir putin
11 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Good News for Trump; An EU Showdown Over Ukraine Looms
#world economic forumviktor orbanukraine conflictblack lives mattercovid 20critical race theorydepartment of justicedonald trumpdonald trump legal challengesgazaglobal health securityhamasharvard universityhenry kissingeribrahim x kendiisrael hamas warjerome corsijoe bidenneo marxism
08 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Bad Week for the Bidens: Impeachment Inquiry for Joe, New Charges for Hunter
#world economic forumunited nationsthe truth centralbiden administrationclimate change denialgazahamashunter bidenhunter biden scandalinflation reduction actiranisrael hamas warjerome corsijoe bidenjoe biden impeachmentjohn kerrymuslim brotherhoodneo marxist conspiracy
07 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left's Climate Colonialism; The 'Energy Transition:' Reason vs. Rhetoric
#world war ii originsukraine warukraine oligarchscarbon creditsclimate colonialismdonald trumpdoug horndr jerome corsieconomic collapseeuropean green dealfranklin d rooseveltgaza incursionhillary clintonjfk assassinationjoe bidenmccallum memorandummedia censorshipmilitary industrial complex
06 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden-Touted E-Bus Company Goes Bust; Is the EU Slowly Admitting the Truth About the Ukraine War?
#zelenskyukraine conflictthetruthcentralbiden administrationclimate policyeconomic collapsegeorge soroshillary clintonisrael hamas warjerome corsijohn kerrykhan younisnato expansionoctober 7th attackproterraqatarsolyndrasultan al jabbar
05 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Net Zero Emissions Agenda is Spiraling
#walking liberty half dollarrishi sunaknet zero tracker15 degree celsiusbritish parliamentclimate policyenergy transitionfinancial marketsgazageopoliticsglobal economicshamasinflation reduction actjerome corsimoodys
04 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hamas and UN as Propaganda Partners; Gold Hits Record High
#unrwa accusationsunrwathe truth centralbiden administrationcarbon 60climate change debatecop28economic collapsegaza citygold marketgold pricehamasiranian influenceisrael hamas warjerome corsijohn kerrymichelle obamamunich olympics massacremy vital coctober 7th attacks
01 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hamas Breaks Treaty, Fighting Resumes; Climate Fanatics Descend on Dubai
#world economic forumviktor orbanukrainebiden administrationbill gatesclimate change policycop28democratic partyeconomic collapseenergy transitiongazagender identityglobalismgold rushhamashenry kissingerhezbollahiranisrael hamas warnato
2023 - November (20)
30 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Khrushchev's Secret Speech - 1956
#woke culturethe truth about neo marxismsecret speechantifaantonio gramsciblack book of communismblack lives mattercommunist historycultural maoismcultural revolutiongovernment controlimaginejerome corsijohn lennonjoseph stalinmao zedongneo marxismnikita khrushchevrobert gallatioli
29 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did Deutsche Bank Just Destroy Letitia James’ Case Against Donald Trump?
#world economic forumseth richscott gallowayagenda 2030ari joffeclimate change skepticismdeutsche bankdonald trumpeconomic crisisfinancial fraudglobalist controlgovernment cover upsjerome corsijoe bidenjulian assangeletitia jamesrobert f kennedy jr
28 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is NATO Deliberately Trying to Provoke Russia?
#world war iiithe truth centralrussiabaltic seabill clintonclimate change denialclinton foundationcultural warseconomic collapseglobal crashhillary clintonjerome corsijohn f kennedylyndon johnsonmilitary industrial complexnatonato expansionobama administrationrobert f kennedy jr
27 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Left's 'Personal Carbon Allowance' Plan and a Look Into The UN COP 28 Talks
#world economic forumwoke social justicewar on foodbill gatescarbon allowancesclimate change denialconspiracy theoriescultural revolutiondigital carbon passportsdr jerome corsieconomic collapsegrand solar minimumian plimeridentity politicslow emission zonesneo marxismthetruthcentralcom
22 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Behind the Israel-Hamas Hostage Agreement; Is NATO Still Relevant?
#world economic forumtranshumanismstagflation50 hostagesbill gatescia conspiracyclimate change denialdavid manticeconomic collapsegerman constitutional courtiran nuclear dealisrael hamas warjerome corsijfk assassinationmaoist cultural revolutionnato obsolescencerichard lindzen
21 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Americans Raiding 401ks to Pay Rent and Mortgage; Elon Musk Takes On Far-Left Media Matters
#ukraine russia warthe truth centralsoft landing2008 subprime crisis401kbidenomicsclinton foundationcredit card debteconomic crisiselon muskfidelitygeorge soroshezbollahhillary clintoninflationisrael hamas warjerome corsimedia censorshipmedia mattersneo marxismpolitical corruption
20 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Argentina Elects Anti-Woke Milei as President; Israel Moves into Tougher Phase of War in Gaza
#woke agendaukrainepolitical polarizationargentinabiden administrationclimate change policycommercial real estate crisisdepopulation movementgazaglobal economic crisishamasiranisrael hamas warjavier mileijerome corsijohn kerrymedia bias
17 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Mao's Cultural Revolution: Where Woke Came from and Where it's Going pt 7
#woke culturethe truth centralstalin2 chronicles 7 14antifablack lives mattercultural revolutiondonald trumpdr jerome corsifrank diköttergreat leap forwardgreat terrorjoe bidenmaoismmao zedongneo marxismred guards
16 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Walter Duranty: Stalin’s PR Agent for the New York Times
#walter durantyukrainian faminestalinaleister crowleyclimate change denialcultural maoismgareth jonesjerome corsikamala harrismalcolm muggeridgemedia censorshipneo marxismnew york timespope carlo viganopostmodern culturesatanism
15 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Europe is Burning; Obama‘s Science Czar John Holdren & the Depopulationist Movement
#world economic forumthe challenge of mans futuresean corsiclimate changeeconomic collapsefrankfurt schoolglobal resetgovernor newsomgreat resetgreen new dealharrison brownherbert marcusejoel corsijohn holdrenjohn kotkinnazi ideologypopulation controlrenewable energysan francisco
14 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Who Stands to Lose More from the RFK Jr. Independent Run: Trump or Biden?
#world economic forumteslasolaredge technologies2024 presidential election2 chronicles 7 14cultural marxismdonald trumpezekiel 37 38gaza hospitalgog and magoggold investingisrael hamas warjill steinjoe bidenrenewable energy economicsrobert f kennedy jrross perotrussia ukraine conflict
13 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
New Fighting by Israel's Northern Border; 'Scientists' Claim Hottest 12 Months in 125,000 Years
#zelenskyworld war iwoke culture1973 oil embargoamerican politicsbiden administrationchina green energyclimate change skepticismelizabeth warrenglobal economic crisishamashezbollahiranian revolutionary guard corpsisrael hamas warjerome corsijimmy carterkamala harrisploukraine conflict
10 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel Tries to Root Out Hamas Amid More Calls for Cease-Fire; Time to Pull the Plug on Forced EVs
#weworkneo marxismmosulchinese technologycultural revolutiondean heskineconomic collapseeuropean unionfordfree market economicsftxgaza citygmgreen energy mandateshamasisisisrael hamas warjerome corsimario draghi
09 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
U.S. Debt INTREST Now Over $1 TRILLION; U.S. Launches Air Strike on Iranian Group in Syria
#us national debtswiss american tradingsilverbank failureschase bankde bankingfdicfinancial privacyjamie dimonjerome corsinational debtncrfphysical goldprecious metalsrichard cromwellsac city bank
08 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Deleuze, Guattari, Butler: False Realities, Gender Theory and Today’s ‘Woke’ Identity Politics
#woke movementwhite privilegeto kill a mockingbirdanti oedipusbiblical interventioncatherine prendergastcultural maoismfélix guattarigender identitygender troublegilles deleuzegreat awakening trilogyjerome corsijudith butlerneo marxismpedophiliapostmodernismqueer theory
07 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump, Judge Clash During Trial in NYC; Netanyahu Says Israel Will Control Gaza
#weworkukraine conflictthetruthcentralcomcommercial real estate crisiscultural maoismdemocratic partydonald trump legal challengesgog and magoggold investmentgreen new dealiranisrael hamas warjerome corsijustice departmentneo marxismnetanyahuoctober 7th attacksrussia
06 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel Airstrikes Hit 450 Gaza Targets; A Brutal Week for the Green Agenda
#world war iiivolodymyr zelenskyukraine fatiguebiden administrationdinesh dsouzaeconomic collapseel niñogreen energy transitionhamashezbollahisrael hamas warjerome corsijohn kerryneo marxismoffshore windthe police statetime magazineukraine conflict
03 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Wagner Group to Aid Hezbollah; Globalists Are Claiming Climate Change is a "Global Health Crisis"
#zaluznyyanukovychworld health organizationclimate change conspiracydonald trumpelaine chaogeorge sorosglobal economic crashhezbollahhillary clintonjerome corsimaidan rebellionmitch mcconnellrussia iran alliancetreasury debtukraine war stalemateus political corruptionwagner group
02 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel's New Calculus: Strike Hamas at All Costs; Putin Defies Nuclear Test Ban Treaty
#political corruptionpinchuknuclear test ban treaty2 chronicles 7 14burismaclimate change denialconnecticut judgeend times prophecygazaglobal economic collapsehamashillary clintonhunter bideniraniranian influenceisrael hamas warjerome corsijohn kerrymaidan rebellionnamazi
01 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How the Left is Falling Apart Over Israel and Hamas; Why a China Crash is Coming
#world war iiius foreign policythe coming global crash will create an historic gold rushanti defamation leagueblack lives matterchina real estate marketcultural marxismeconomic collapseelectric vehiclesgold investinghezbollahhyperinflationirs offsetsisrael hamas warjerome corsimike johnsonoffshore wind
2023 - October (22)
31 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel's Counterattack Continues; U.S. to Borrow $1.5 Trillion More Debt in Q4
#world war iiipolitical corruptionnational debt2 chronicles 7 14astrazenecabric nationsclimate change hoaxdemocratic partygold rushhamashillary clintonhunter bidenipcciranisrael gaza warjerome corsimodern monetary theory
30 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Big Bond Bear Market Could Be On the Way; Israel Makes its Move in Gaza
#woke culturepolitical corruptionoctober 7th attacks2008 subprime crisisbear marketclimate change hysteriaelectric vehicle mandatesgaza wargeorge sorosglobal economic crisisgold investmenthezbollahhunter bidenisrael hamas warjerome corsimortgage market collapsemortgage sectornational debtneo marxist agendaoctober 30 2023
27 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Max Horkheimer, Theodore Adorno and Neo-Marxist Theory - Where Woke Came From and Where it's Going Pt 6
#woke ideologyvtruthcentraltransgender issuescultural industrycultural maoismdialectics of enlightenmentfeminismfrankfurt schoolidentity politicsimmanuel kantjerome corsijuliettekarl marxmarquis de sademax horkheimerreligious repentancetheodor adorno
26 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Herbert Marcuse: The Father of the New Left - Where Woke Came From and Where It's Going Pt 5
#woke insanityvietnam warthe truth about neo marxismabbie hoffmana critique of pure toleranceangela davisbill gatescritical race theorycultural maoismeros and civilizationfrankfurt schoolglobalist conspiracyherbert marcuseidentity politicsjerome corsijohn f kennedyjohn rawlsjürgen habermasklaus schwabneo marxismnew leftone dimensional manrepressive tolerancetheodore allen
25 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Howard Zinn's Fake History: Where Woke Came From and Where it's Going Part 4
#woke culturethomas jeffersonsidney powellanarchycultural maoismdeep truth centraleconomic collapseglobal crashgold rushhillary clintonhistoric gold rushhoward zinnjenna ellisjerome corsineo marxismpostmodernismsaul alinsky
24 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Where Woke Came From and Where it's Going: Hegel and Marx -- Part 3 in a Series
#world economic forumtsar nicholas iitranshumanismantonio gramscicultural maoismdepopulation movementseconomic collapsefederal reserveglobalist new world ordergreat awakening trilogyidentity politicsjerome corsikarl marxleninneo marxismsean mckeeganthe truth about neo marxism
23 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Neo-Marxist Foundations of Today's Woke Culture
#woke culturewilliam z fosterweather undergroundbarack obamabella doddbill ayerscommunist infiltrationeconomic collapsefrank marshall davishouse un american activities committeejack kawanojerome corsikarl marxmedia censorshipneo marxismthe truth about neo marxism
20 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Rocket Attacks on Israel Could Lead to a Full Regional Conflict
#world economic forumsocial credit systemspresident bidencbdceconomic collapse predictionsgaza cityglobalist conspiracy theoriesgold pricesgovernment corruption allegationshamasiraniran regional conflictisrael hamas warjerome corsijoe mccorskeyjulian assangeklaus schwabmueller investigation
19 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are We Headed for a New World War?
#world economic forumunited nationsukraine warbiden administrationclimate change hoaxclinton foundationglobal economic crashgold rushgreat resethamashsbciranjerome corsimichael mannmiddle east conflictnatoneo marxists
18 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bidenvilles; The New Hoovervilles; Inside the Explosion at Al-Ahli Hospital in Gaza
#world war threerobert f kennedy jrreligious judgment2 chronicles 7 14al ahli hospitalbidenvilleseconomic collapsegaza conflictgold rushhamashezbollahiranisrael hamas warjerome corsijoe bidenoctober 7th attackspolitical extremism
17 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Roots of Wokeism: How it All Started
#water vaportranshumanismthe truth about neo marxismantonio gramscibill gatescultural maoismcultural revolutiondr jerome corsifrankfurt schoolgodidentity politicsmichel foucaultneo marxismpostmodernism
16 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
FBI Warns of Hamas Attacks on US Soil; Housing Market to Further Sink
#world war iiiuaw strikethe truth centralbiblical prophecybiden administrationcommercial real estateeconomic recessiongold priceshamashezbollahisrael hamas warjerome corsimagogneo marxist policiespolitical impeachmentrobert hur
13 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will the Dems Push Michelle Obama as their 2024 Prez Nominee? Joel Gilbert joins Dr. Jerome Corsi
#weather undergroundthe truth centralsouth carolina primarybarack obamabernadine dorncabrini greenchicago conventiondemocratic partyfrank marshall davisisrael hamas warjerome corsijoel gilbertmichelle obamamichelle obama 2024political conspiraciesracial discriminationrichard daley
12 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside the Israel-Hamas Conflict and What the Abraham Accords Missed
#yom kippur warworld war iiiwoke neo marxismabraham accordsantifablmciacommercial real estateezekiel 37 38federal reserveglobal economic crashgold market speculationhsbcisrael hamas warjerome corsimiddle east geopoliticsopec embargo
11 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel: Facing War from Multiple Sides
#us foreign policythetruthcentralreligious interpretationatomic iranclinton foundationconspiracy theorieshamashezbollahiraniran nuclear programisrael hamas conflictisrael hamas warjake sullivanjerome corsijoe bidenjoel mccorseyjohn kerry
10 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Israel vs. Hamas: The Truth and What's Next?
#yom kippur warworld war iiiopen bordersbiden administrationclimate change activismgazahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsineo marxism
09 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran Helped Hamas Plan Attack on Israel; Why Oil Could Hit $150 per Barrel
#obama administrationnew world orderneo marxismbiblical prophecybiden administrationclimate change skepticismcloward piven strategycommercial real estate bubbleeconomic crisisepahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsimilitary industrial complex
06 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden to Build More of Trump's Border Wall; The Race to be the Next House Speaker
#the truth centralpioneer natural resourcesjim jordanamerican politicsbiden administrationclimate change debatedemocratic partydonald trumpexxonglobal economicsgramscigreen energygreen energy policygreen murderian plimerimmigration policyjerome corsi
05 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
FBI Targeting Trump Supporters Ahead of 2024 Election; OPEC Says Oil Could Hit $100 per Barrel
#un net zero banking allianceunited auto workersukraine warbiden administrationclimate change denialcultural maoismeconomic collapseeducation reformenergy securityepa mandatesesg policiesfbigeneral motorsgovernment surveillancejerome corsilabor unionslatin massnato expansionopecthetruthcentral
04 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Scientism, De-Populationists & the Climate Cult
#zbigniew brzezinskitranshumanismthe first global revolutionclimate change denialclimategateclub of romeecosciencegeorge sorosgreat resethenry kissingerjean baudrillardjerome corsijohn holdrenjürgen habermasmichael mannone world governmentpaul ehrlichpopulation controlpostmodernism
03 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Putin Holds Nuclear Drill, Testing Bombs; RKF Jr. Going Independent
#vladimir zelenskythird party politicsrussia ukraine warbanking crisisbarack obamaclimate change denialclub of romecommercial real estatedmytro kolomoiskyfloyd batesgeorge sorosgold rushjoe bidenkevin mccarthymatt gaetznato expansionrobert kennedy jr
02 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will McCarthy be Ousted as Speaker? How the Global Elite Created "Climate Change" to Establish a New World Order
#russia sanctionsrobert kennedy jroperation mockingbirdbill gateschina real estateclimate changeclub of romecultural maoismdepopulation agendaespionage actgeorge sorosglobal economic crashhenry kissingerjerome corsikevin mccarthykissinger reportmatt gaetzneo marxism
2023 - September (20)
29 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden Impeachment Hearing Bombshell: The Inevitable EV Implosion
#world war iiiukraine aidoleg kolomoiskybiblical principlesburismacommercial real estatedepartment of justiceelectric vehicle mandatesgovernment shutdownhouse oversight committeeimpeachment hearingsjames comerjerome corsijoe bidenkamala harrismass immigrationmichelle obamaneo marxism
28 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Countdown to a Shutdown? New Memos Spark More Biden Corruption Charges
#wuhan labswoke neo marxist agendasurveillance stateanthony faucibiden familyburismaciaclinton foundationcovid 19 originsentitlement spendingforeign agents registration actforeign corruptiongain of function researchglobal credit crisisgovernment shutdownhillary clintonjerome corsijim jordanmatt gaetzmilitary industrial complex
27 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why We're Not Ready for an Economic Worst-Case Scenario; Why Bill Gates is Running From the Climate Doom Narrative
#the truth centralswiss americasars cov 2anthony faucibill gatesclimate change hoaxeconomic inflationgovernment corruptionhunter bidenjamie dimonjerome corsijoe bidenmodern monetary theorypanasonic evphiladelphia lootingpublic health conspiracyreligious repentance
26 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Devon Archer Sings, Exposes Joe Biden Lies; Woke Fads Headed for History's Trash Bin
#social justice movementspolitical corruptionoccupy wall streetbill gatesblack lives matterbob menendezcarbon 60climate changedepartment of justicedevin archerfederal reservegeorge soroshunter bidenjoe bidenme toomrna vaccinesnew world order
25 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is mRNA Vaccine-Laced Meat Coming Soon? Oil to Hit $100?
#us national debtthetruthcentralcomrussia ukraine war2024 presidential electionbob menendezconstitutional principlesdonald trumpeconomic stagflationespionage act of 1917federal reservegeorge soroshillary clintonhunter bidenjerome corsimichelle obamamrna vaccinesnato expansionnet zero climate policies
22 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Marxism's Dark History: Starvation as a Political Weapon
#woke culturetotalitarianismthetruthcentralcombella doddcritical theorydialectic of enlightenmentfrankfurt schoolgreat leap forwardgustavo gutiérrezherbert marcuseholodomorjerome corsiliberation theologymao zedongneo marxismstalinsustainable development goals
21 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Poland to Stop Arming Ukraine; Big Q4 GDP Downturn Coming
#uaw strikesthe truth centraltaiwan invasionchina military drillsclimate change policyclinton foundationeconomic recessionelectric vehicleselectrification debatefederal reservefederal reserve policygeopolitical conflictjerome corsikevin mccarthynancy pelosirobert kennedy jr
20 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Leaked: A Plan to Oust McCarthy; Blue Mayor's Eco-Totalitarian Overreach
#world bankshadowstatsmichelle obamaclimate change denialcovid 19david kopelianeconomic inflationfdagold investmentgovernment shutdownivermectinjanet yellenjerome corsijoe bidenkate gallegokevin mccarthymarxist agendamatt gaetz
19 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Zelenskyy to Ask for More Billions; US Debt Topples $33 TRILLION
#victoria nulandukrainian forcesukraine warbiden administrationclimate changeeconomic collapseelectric vehiclesjohn kerryklaus schwabmgm 140 atacmsnational debtnatoneo marxismnuclear conflictpresident zelenskyysafe t act
18 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The CCP's New Bio-Weapon Plan; The EV Honeymoon is Over
#world economic forumshadow statsopecamerican library associationbill gatesbricsclimate change denialcultural marxismdow joneseconomic collapseenergy transitionfreedom caucusglobal health crisisgovernment shutdownjerome corsikevin mccarthyklaus schwabmarjorie taylor greenematt gaetznational security directive 200
15 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hunter Biden Indicted; How Bidenomics is Destroying Our Economy
#yuval noah harariyoutube shadowbanningthe truth centralarchbishop viganobidenomicsbricseconomic collapsegeopolitical conflicthunter bidenhunter biden indictmentinternational energy agencyjerome corsijoe bidenjoe biden impeachmentkamala harrismedia censorshipreligious freedomrumble
14 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Dirty Secret About How Masks Really "Work" and Marching Orders to Media Are in Over Biden Impeachment Plan
#ukraine russia conflicttruth centralsmart metersbarack obamaeducation reformgovernment surveillancehenry kissingerhunter bidenhydroxychloroquineinternational conflictivermectinjerome corsijoe bidenmrna vaccinesnational security memorandum 200political corruptionpublic health policy
13 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden Impeachment Plans Are a Go; China Using AI to Spread Disinformation
#zelenskyworld economic forumwashington post9 11biden administrationbricsbrics allianceconspiracy theorieseconomic declinehunter bidenimpeachment hearingsjerome corsijfk assassinationjoe bidenkamala harrisnew york timesopecukraine war
12 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden to Send $6B to Iran; An "Emergency Approval" For the New COVID Vax
#zelenskyukraine warukraine counteroffensivebiden administrationbricsbrics expansionclimate change denialclimate hoaxcovid 19 vaccineseconomic collapseeg5 variantfdafifth circuit courtgold pricesgreen heating lawhunter bideniraniran nuclear dealisraelivermectinjerome corsi
11 Sep
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How the Government Used 9/11 to Weaponize Itself; The Energy Secretary's Embarrassing EV Photo Op
#warren commissionsidney powellsecond amendmentbiden administrationcovid 19donald trumpelectric vehiclesgovernment surveillanceiranjennifer granholmjfk assassinationjoan corzinemichelle lujan grishammyvitalcpatriot actpaul landis
08 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How the Great Resetters Plan to Lock EVERYONE into 15 Minute Cities by 2030
#woke culture critiqueus china economic conflicttotalitarian control14th amendmentbarack obamabricsclimate change skepticismelon muskesg investingfederal reservehunter bidenjanuary 6th investigationjanuary 6th select committeejudith currylawfare against trumppeter navarrostarlinkstrive asset management
07 Sep
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US Sinking Another $1B Into Ukraine War Disaster; EV Hoax Exposed
#zelenskyworld economic forumwoke culturecovid 19 conspiracydonbasseconomic declineelectric vehiclesfoundation for individual rights in expressionfree speechgreat resetharvard universityjerome corsijoe bidenjohn kerrynatothe truth centralukraineukraine warvladimir putin
06 Sep
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Deep Ukraine-Maui Funding Disparity; China to Control Global Energy Market?
#world economic forumukraine war fundingtranshumanismbiden administrationbricsburismadonald trumpelection fraudfiat currencyglobal de dollarizationhunter bidenihor kolomoiskyjerome corsemaui wildfiresnato expansionneo marxismswiss america
05 Sep
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Fauci, Narrative Against Ivermectin Rebuffed; ESG Headed Toward Dustbin of History
#woke agendaukraine warstate department2 chronicles 7 142slgbtqi+climate changedonald trumpdr jerome corsieconomic collapseenvironmental protection agencyesg investingfdafifth circuit court of appealsgovernment overreachivermectinlouisiana wildfiresmaui wildfiresnew jersey offshore windreligious freedom
01 Sep
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Inside Biden's Secret E-Mails and the Biggest Story in America Not Being Reported
#zachary rellyougovproud boys14th amendmentantifaclimate change denialclinton foundationdr jerome corsielection integritygreen dealhunter bidenjoe biggsjudicial biasmantanational security memorandum 200neo marxismpolitical corruptionpresident bidenpresident obama
2023 - August (23)
31 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Get Ready for a Recession, Stagflation; BRICS Poised to Control Global Energy Supply, Currency
#woke ideologywarren buffetttranshumanismal gorebricsciaconspiracy theoriescultural wareconomic recessionfederal reservegeopoliticshousing marketinflationjerome corsimichael burrymodern monetary theorysaudi arabiathe truth central
30 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
National Archives Reveals Biden Used Fake Names to Email Sensitive Info to Hunter; A Plan to Un-Bloat the Federal Government
#project 2025national archivesmedia biasassociated pressbiden emailsclimate change denialdepartment of justicedonald trumpelection fraudgreen murderheritage foundationhunter bidenian plimerjerome corsijohn clauser
29 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Judge Deciding Trump’s Fate in the 2024 Election Comes From Family of Marxist “Revolutionaries”
#tucker carlsonthe truth centralpolitical corruptionantifabarack obamabill clintonblack lives matterclimate change denialcultural marxismdonald trumpdr jerome corsielection fraudgeorge sorosjoe bidenjudge tanya chutkanjudicial biaskevin mccarthymitch mcconnell
28 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will House Republicans Really Impeach Biden? Top Law Schools Propose Ditching the Constitution
#yaleviktor shokinukraine aid1619 projectclimate changecritical race theorydevin archerdonald trumpharvardhunter bidenimpeachmentjerome corsijoe bidenjohn kerrymodern monetary theoryneo marxismstanfordtotalitarianism
25 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump's Historic Mugshot; The Left's New Scam-Demic COVID Narrative Strategy
#will happerrichard lindzenmail in ballotsanthony faucibricsbrics allianceclimate change denialcovid 19donald trumpelection interferencefederal reserveglobal coolinggold standardhunter bidenjerome corsilawfaremaidan rebellion
24 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Republican Primary Debate Analysis; Will New EPA Regulations Starve Millions?
#yevgeny prigozhinwill happerwagner groupbret baierchris christiechris wallaceclimate change denialdonald trumpeconomic collapseepa regulationsgeorge sorosgovernment distrustjerome corsimike penceneo marxismreince priebusrepublican debaterichard lindzenron desantisrussia ukraine war
23 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Is Global De-Dollarization Irreversible? Why the Lawfare Against Trump is Unconstitutional
#vladimir putinukraine wartonga volcanic eruption14th amendmentbretton woodsbrics nationsclimate change denialdollar de dollarizationdonald trumpdonald trump legal challengeshillary clintonjerome corsijoe bidenlula da silvamaui wildfiresreligious valuesswiss americathetruthcentralcom
22 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will Car Prices Become Unsustainable for Buyers? Why the Ukraine War Must End
#whounukraine waragenda 2030colonel mcgregorconspiracy theoriesdonald trumpeconomic collapseelectric vehiclesgeorge soroshillary clintonhunter bidenjerome corsimaidan rebellionmedia censorshipmilitary intervention
21 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
U.S. Banks Take $18.9B in Losses; Are "Climate Emergency" Lockdowns Coming?
#world economic forumpolitical polarizationneo marxism401ksbiden administrationbill gatesbricscommercial real estateconspiracy theoriescritical race theorydonald trumpeconomic collapseerisevergrandefinancial crisisglobal governancejerome corsi
18 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Has Putin Already Achieved His Goals in Ukraine? Will Michelle Obama Run in 2024?
#zhongnong international trustwestchester countyvladimir putin2024 electionaffirmative actionalexander lukashenkocountry garden holdingsdemocratic party strategydonald trumpf 16housing market crashhud rulejerome corsijoe manchinmichelle obamanatoneo marxismno labels partysan francisco housingstudent loan debtted cruzukraine warus student loans
17 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Another Way Lawfare vs. Trump Could Backfire: San Francisco's Downward Spiral Continues
#ukraine warsocial unrestsan franciscoandy harrisantifaantony blinkenbricsdonald trumpeconomic collapsegeorge soroshillary clintonjake sullivanjerome corsikarl poppernato expansionpolitical corruptionrinat akhmetov
16 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Reckless Policies Endanger the U.S. Middle Class; Is it Time to Ban EVs?
#political corruptionnew marxismmilankovitch cyclesantifablackrockcbdcclimate change denialeconomic declineelectric vehiclesglobal conflictinflation crisisjerome corsejoe bidenmaui wildfiresmichael snyder
15 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Scientists: EPA Regulations Based on a Hoax; School Attendance Plummets Nationwide
#will happertucker carlsontonga volcanoclimate change denialconspiracy theoriescritical race theorydonald trumpeducation reformelection integrityel niñoepa regulationsjerome corsipolitical polarizationrichard lindzenrobert kennedy jrrudy giulianisidney powell
14 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Ukrainian Counteroffensive is Failing; Will Parts of the US Become Ungovernable?
#westfield topanga mallweaponized dollarultra low emission zonebiden administrationbricsclimate change denialcritical race theoryeconomic collapsegovernment conspiracy theoriesjerome corsinational security study memorandum 200nordstrom storereligious revivaltruth centralukraine counteroffensive
11 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
EPA Pushes Unproven Tech for Green Agenda; US Education Quality Poorer, But Tops in Indoctrination
#twitterreligious freedompolitical harassmentabortionantifaclimate change debatecritical race theorydepartment of justicedonald trumpeducation indoctrinationepajack smithjonathan turleyjudge burl howelllatin masslegal proceedings
10 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bank Records Show Biden Family Received Millions in Payouts from Russia, Ukraine & Kazakhstan
#yelena baturinathetruthcentralstock market crashbiden foreign paymentscbdcchristopher wrayclimate change conspiracydevin archerfbi religious persecutionhunter bidenhunter biden corruptionjerome corsijoe bidenlatin massneo marxistsrosemont seneca thornton
09 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Did Jack Smith Open the Door to an Examination of the 2020 Election?
#world economic forumtonga volcanic eruptionroger simonanderson economic groupcharles mcgonigalchina gold reservesclimate change denialdarius paskadebbie wasserman schultzdonald trumpeconomic declineelection integrityfirst amendment rightsimmigration policyjack smithjoe bidenmandt bankmerrick garland
08 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How Trump's Indictments Could Backfire on Biden; The Real Threats to America
#walking liberty half dollarvictor davis hansonthetruthcentralcom2020 election fraud claimsamy jackson bermanclimate change denialdepartment of justice corruptiondevlin archerdonald trumpeconomic recessionespionage acteugene debsfirst amendment rightsfitch ratingshunter bidenjerome corsijoe bidenjudge eileen cannonpost modernism critique
07 Aug
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pence's Testimony Could Prove Trump's Innocence in Jan 6th Case; Bidenomics Leads to Lower US Credit Rating
#us credit ratingthe truth centralroe v wadeclimate change conspiracydepartment of justicedonald trump legal challengeseconomic recessionfitch ratingsgeorge w bushhunter bidenjanuary 6thjerome corsikissinger reportmike pencenssm 200paris agreementpolitical bias
04 Aug
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Marcuse's Utopia, Post-Modernism and Today's Left
#world economic forumtranshumanismthe truth centralclimate changeeros and civilizationfrankfurt schoolglobal warminggreat awakening trilogyherbert marcusejerome corsineo marxismone dimensional manpostmodernismrepressive tolerance
03 Aug
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Jean Baudrillard, Post-Modernism, the Matrix and the Truth
#woke movementthe matrixsimulacrumclimate changecultural maoismfrankfurt schoolgodgulf war did not take placejean baudrillardjerome corsineo marxismobjective realitypostmodernism
02 Aug
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Totalitarians Have Adopted the "Man-Made Climate Change" Agenda
#washington posttotalitarian controlnew york timesapocalypse neverclimate change denialclimategatedr jerome corsiedward lorenzfossil futureglobal warming conspiracygreen energy transitionipccjohn clauserjudith currymarxist ideologymatthias desmetmichael mann
01 Aug
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Defending Your Money from a Potential Global Economic Crash - with Swiss America CEO Dean Heskin
#swiss americast louissan francisco2008 subprime collapsecbdccentral bank digital currenciescommercial real estatecommercial real estate bubbledean heskineconomic inflationfednowfinancial crisisgold investmentgold rushjerome corsijimmy cartermenu grocery products
2023 - July (19)
31 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
NATO's Dance with Ukraine and Are We Headed Toward WW3 - with Tony Shaffer
#xrpworld war iiivladimir putinbudapest memorandumcentral bank digital currencyclimate change skepticismfederal reservefednowgeorge sorosglobalist conspiracyjake sullivanjerome corsinatonato expansionnew world ordertony shafferukraine
28 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Kissinger Report: US Government’s Policy to Depopulate the World
#world economic forumtechnological surveillancerobert malonecouncil on foreign relationsdigital currencyelectric vehiclesglobal governancehenry kissingerjerome corsejohn holdrenjulian simonklaus schwabmalthusian theorynational security memorandumpaul ehrlichpopulation controlresource scarcity
27 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hunter Biden Wrist-Slap Denied; Fed Hikes Interest Rate to 22-Year High
#ukraine war critiqueukraine warthe great liecivilizational declineclimate change denialenergy policy critiquefederal reservegeorge kennanhunter bidenhunter biden caseinflation reduction actjoe ancorsilynn balzermalthusian theorymonetary policy analysisnato expansionneo marxismsan francisco
26 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Crime in Dem-Run Cities Worse Than You Think; Media Runs Defense for Impeachment-Bound Biden
#political corruptionneo marxismjonathan turleyblack lives matterchrisciaconspiracy theoriescrime statisticsdeep statedemocratic partydevin archerelection integrityenergy policyhsbchunter bidenjerome corsijoe biden
25 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Destruction of the Middle Class; Biden Targets Your Water Heater
#robert f kennedy jrpolitical polarizationmedia censorshipbarack obamabiden administrationclimate change denialconspiracy theoriesdepartment of energydigital services actdonald trumpfisa courtsfrank marshall davisgovernment surveillancehillary clintonhunter bidenjerome corsijoe rogankathy hochul
24 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bidenflation is Not Going Away Soon; Is D-E-I Going to D-I-E?
#world economic forumukraine warsocial justicechina taiwan invasionclimate gateclimate sciencedei programseconomic collapseedward norton lorenzglobal conflictipcc consensusjohn clauserjudith currymichael mannpolitical corruptionroe v wade
21 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
No, It's Not Okay for the Government to Constantly Lie to Us - From Lessons Learned Through History
#woke culturetotalitarianismthe psychology of totalitarianismchurch committeecointelproday of deceptiondouglas horndr jerome corsifrank churchfranklin d rooseveltgovernment deceptionintelligence agenciesjames risenmartin luther king jrmatthias desmetneo marxismpearl harborrobert stennett
20 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Exactly How Disastrous Have the Ukraine War and Influence-Peddling Allegations Been for Biden?
#us justice systemukraine warthe truth centralbiden family corruptionclimate change denialcointelprodemocratic party critiqueelectric vehicleshouse oversight committeehunter bidenjerome corsijudith curryjulian assangenavier stokes equationsneo nazi factionoperation crossfire hurricanesteele dossier
19 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US Sends Fighter Jets to Gulf of Oman; BRICS Gold-Backed Currency Project Gains Speed
#us dollarukraine warswift sanctionsbiden administrationbricsbrics goldclimate change scienceclimate change skepticismdollar weaponizationf 16 jetsglobal financial crisisiran nuclear programisraeljerome corsiodessaponzi schemeraymond voyagersouth africastrait of hormuz
18 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Climate Lockdowns Begin; Pentagon Finally Admits Failure as Ukraine Counter-Offensive Sputters
#zelenskyworld war iiiukraine warbiden administrationblackrockclimate policyeconomic collapseesg investingfbigovernment corruptionjerome corsilarry finknato expansionrobert f kennedy jrthe truth central
17 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Globalists Publish Plan for Worldwide Financial ENSLAVEMENT Via a Unified Ledger
#zoltan pozarzelenskyukrainebricsbrics currencycbdccentral bank digital currenciesclimate change denialcommercial real estate crisisdaniel greenfielddonald trumpel niñojerome corsijoe bidennato expansionswiftswiss americatransgender rights
14 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Marxists Declare 1st Amendment a "Psychological Disorder;" US Debt Interest Payments to Hit $1 TRILLION
#zelenskyxrp lawsuitxrpbitcoincentral bank digital currenciesclimate change debateco2 coalitiondemocratic party historyfbifederal debt crisisfederal reservefirst amendment rightsinformation disorder syndromejerome corsijohn clauserjohn kerryponzi schemeroe v wadesecukrainian spy agency
13 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Bidenomics Equals Stagflation; UN Sustainability Agenda: Destroy the Middle Class
#world economic forumstate farmstagflationallstatebiden administrationclimate changecommercial real estateconsumer price indexcultural maoismelectric vehiclesfarmers insuranceglobal governancegoldimfjerome corsijudith currynationwide mutual
12 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US vs. NATO Allies on Ukraine Membership; California Crime Surges, Arrests Down
#world war ii originsworld economic forumukraine nato membershipbiden administrationclimate change denialdouglas hornelectric vehicle mandatesfranklin d rooseveltgeorge sorosglobalist conspiracy theorieshillary clintonmaidan revolutionnato article 5nitrogen fertilizerspearl harborthe mccollum memorandum
11 Jul
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US vs. NATO Allies on Ukraine Membership; California Crime Surges, Arrests Down
#ukrainethe truth centralsocial collapsebanking crisisbill gatescalifornia crime ratesclilverd minimumclimate change hoaxdr jerome corsigender fluidityklaus schwabmatthias desmetnato expansionneo marxismpresident biden
10 Jul
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Plan to Block Out the Sun; Mortgage Payments at Record High
#woke ideologyukraine warthetruthcentralbricschernobylclimate change solutionscommercial real estate crashde dollarizationdutch governmentfederal reservefrance riotsglobal economic collapsejerome corsinirmal kandelrussiashanghai cooperation organizationswiss americathe coming global crash
07 Jul
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Americans Lost $1.76 TRILLION in Savings Since 2020; The Recession We Were Expecting is Already Here
#united states recessionthetruthcentralsocial media regulationaffirmative actionaffirmative action decisionasian americansbiden administrationcalifornia exoduscritical race theorycultural marxismeconomic collapsejerome corsinational debtneo marxistspersonal savings ratepolitical migrationsocial media censorship
06 Jul
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
America's Child Trafficking Shame; Is NATO Pushing Us Toward War with Russia?
#violent crimetim wilsonsomaliachicagocongofbigun controljohn lottjustifiable homicideslaw enforcementnazi regimenew york citypete obrienphiladelphiasecond amendmentself defense
05 Jul
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Another Victory for Free Speech over Censorship; What Happens if the BRICS Launch a New Currency?
#xrpwalking liberty half dollarus dollarbiden administrationbricsbrics allianceclimate change denialde dollarizationeconomic collapsegold standardgovernment censorshipjerome corsilouisiana injunctionopecreligious freedomroe v wadeswift systemthe coming global crash
2023 - June (22)
30 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Supreme Court Shuts Down Race-Based College Admissions; BRICS on the March
#transhumanismtransgenderismthetruthcentralcomaffirmative actionbelt and road initiativebrics expansionclimate change hoaxde dollarizationdr jerome corsieconomic stagflationlos angelesnew york citypharmaceutical companiesray spencerroosevelt hotelsupreme court
29 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Chinese Saboteurs Coming to America; Identity Politics: The Gateway to Transhumanism
#world war iiiukraine wartruth centralantony blinkenbill gateschina threatcommercial real estateeconomic recessionesg investinggordon changgreen energyhunter bidenhunter biden laptopinverted yield curvejerome corsineo marxismtaiwantranshumanism
28 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Iran Close to Testing First Nukes; EU Wants to Block Out the Sun
#the truth centralsvensmarksolyndrabiden administrationbill gatesbud lightchristensenclimate changecultural decaydonald trumpeconomic declinehamashunter bidenipccjerome corsilordstown motorspolitical corruptionsolar activity
27 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Woke Hollywood Going Broke; First-Time Unemployment Claims Highest Since Oct 2021
#woke ideologyturning redtotalitarianismalex pollackclimate change denialclimatismcritical race theorydonald trumpeconomic declineeuropean central bankford motor companygerman bundesbankindiana jones and the dial of destinyjerome corsijoe bidenjonathan cahnkohei saitolightyearlord of the rings the rings of powermarxism critiquematthias desmetmichael snydermike hulmepeter pan and wendysan franciscostrange worldthe little mermaid
26 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden's Catastrophic Failures, Macron's International Tax Plan and China's Failing Economy
#truth centralnato article 5milankovitch cyclesbiden administrationclimate change denialconspiracy theorieseconomic collapseesg investinghermeticahunter bidenjerome corsijohn kerryjonathan cahnklaus schwablondon breed
23 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
New Bank Crisis Looms; The UN Plans a Digital Censorship Compact
#wells fargourban decaytitan submersiblebanking crisisbiden administrationcitizens bankcommercial real estatecultural marxismcustomers bancorpdepartment of justicedigital currencydurham reporterisa pensionsesg rulesfaucifederal reserve policygarlandhunter bidenjerome corsianjp morgan chasekiwi grocery storespacwestportlandrema 1000san franciscosanta monicaseattle
22 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
New Low Test Scores Expose State of US Education; The Housing Market is Dying
#transgender therapythe truth centralpuberty blockersblackrockclimate change denialcritical race theoryeconomic collapseeducation declineesg assetsfederal reservegeorge papadopouloshousing crisisjerome corsimifsudmilankovitch cyclesneo marxismnew york times
21 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Hunter's Slap on the Wrist; How the Fed is Rigging the Stock Markets to Crash
#ukraine warswiss americasteele dossierbarack obamablackrockclimate change denialdonald trumpeconomic collapseesg investinggeorge soroshillary clintonjames okeefejoe bidenjohn durhamlgbtqia2slgbtqia2s trainingmilankovitch cyclesrussian collusion
20 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Lawfare: The Leftists' Political War on Donald Trump; More Nations Turn to BRICS as De-Dollarization Continues
#ukraine conflictthe truth centralpope francisandrew weissmanbricsclimate changeconstitutional authorityde dollarizationdonald trumpeconomic collapseespionage actfederal reservejerome corsijohn kerrylarry tribelawfaremerrick garlandneo marxism
19 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Worldwide Inflation Is Not Going Away; The Global Food Shortage Gets Worse
#world economic forumworld central bankwar in ukraineclimate change policyconspiracy theorieseconomic collapseeducational reformfederal reservefiat money printinggain of function researchgeorge sorosglobal food shortagegold and silverhillary clintonhoward zinninflation crisisjerome corsimaidan rebellionmilankovitch cyclessan francisco
16 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Decline of Affordable Housing; More Danger for Regional Banks - The Truth Central
#world economic forumtiny housesthe truth centralbill gatescommercial real estate crisiscommercial real estate loansdean heskindonald trumpespionage actfederal reserve policygold market speculationgold rushhousing affordabilityjerome corsipolitical censorshipregional banksstudent loan debtstudent loan repayment pause
15 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US Government Using Data Brokers to Spy on You; China Wins Net Zero Sweepstakes
#trump indictmentthe truth centralpresident bidencommercial real estatedaniel kleindisinformationdr jerome corsieconomic collapseespionage actgold and silvergold investinggovernment surveillancehillary clintonhl menckenlarry tribelawfaremarxismnet zero policies
14 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Trump Indictment: Weak and Embarrassing - A Deep Dive into the "Charges"
#world economic forumpresidential records actpresidential indictmentamy berman jacksonbiden administrationbill clintonclimate changecultural marxismdonald trumpespionage actespionage act of 1917hillary clintoniranisrael nuclear weaponsjerome corsijohn kerrykohei saitomatt gaetznational debtnewsmax
13 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Burisma Owner Says He Has Proof of Biden Taking Bribes; Is the EU Covering Up a Scandal of its Own?
#william barrwestfield groupviktor yanukovychchristopher wrayclimate change policycommercial mortgage backed securitiescommercial real estateconspiracy theorieseconomic collapseeva kailigeorge soroshunter bidenjerome corsijoe bidenklaus schwabkohei saitolinear no threshold modelpolitical corruptionthetruthcentral
12 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Polls Up After Indictment; Are Canadian Wildfires a Result of Eco-Terrorism?
#urban crisisukrainian briberysan franciscoclimate change denialcolumbia business schoolcultural marxismdonald trumpeconomic declinehandmheartland institutejerome corsijoe bidennew york citynoaanordstromnyu stern business schoolpolitical persecution
09 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Trump Indictment: US Has Become a Banana Republic; NATO May Send Troops to Ukraine
#seth richreligious freedomproposition 47biden administrationchristopher wrayclimate change skepticismcoup detatcriminalization of politicsdonald trumpeconomic collapseinstagramjohn robertsjulian assangemetapolitical witch hunt
08 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Here Come the Climate Lockdowns; Global Economic Growth Sinks
#washington posttransgender ideologythetruthcentralcombiden administrationcanadian wildfiresclimate changecritical race theorydepartment of energydr jerome corsieconomic crisisgold and silvergreen movementpride monthreligious freedom
07 Jun
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Tucker's Triumphant Return; US Debt Spikes After Ceiling Agreement
#tucker carlsonthe truth centralsackett v epa2008 financial crisiscommercial real estateeconomic collapseenvironmental regulationfbi corruptionfederal reserve policygold priceshillary clintonhilton hotelsjerome corsikakhovka dammueller investigationpark 55political corruption
06 Jun
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
WHO Already Prepping for Next Health Crisis; More Proof Lockdowns Were Failures
#world health organizationwalter durantyukraineclimate changeendotoxinsgeopoliticsgold rushinstitute of economic affairsjerome corsilab grown meatneo marxismnew york timesnuclear warpandemic policyrussiastalinthe truth central
05 Jun
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
AI's Extinction Risk; Ireland May Kill 200,000 Cows to Please Climate Activists
#world economic forumpolitical persecutionplandemic 3artificial intelligencebricsclimate changeconspiracy theoriesdepartment of justicedonald trumpdr zelenkofast and furiousfbiglobal nuclear warjerome corsijoe bidenjohn kerryklaus schwab
02 Jun
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Leftist Green Agenda Buying Positive Coverage as Evidence of its Failings Mount
#william and flora hewlett foundationthetruthcentralstudent loan cancellationassociated pressbiden student loan programbrics nationscalifornia homelessnessgeopolitical conflictglobal economic collapsegreen energy transitioniran nuclear programjaguar electric suv recalljerome corsemedia influenceopec crisisoperation mockingbirdrockefeller foundation
01 Jun
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
A Debt-Ceiling Deal Which Does Not Deal With Debt; Iran Wants US Out of Syria
#zelenskywill happerus debt ceilingblackrockclimate policydebt ceilingesg investinggeopolitical conflictgold priceshousing marketiranjonathan cahnkier starmerlarry finkmortgage ratesnorth sea oilsecularismthe return of the godsukraine
2023 - May (22)
31 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Tide Turns Against Climate Change Fanatics; Debt Ceiling Agreement Orders Student Loan Payments to Resume
#zerohedgeukraine warstudent loansantarctic doomsday glacierbiden administrationclimate changedean heskindebt ceilingepoch timesgeopoliticshans mohnkehillary clintoninflationjerome corsistudent loan forgiveness
30 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Store Closings Loom, Economic Impact of El Nino and The Ukraine War Heading into the Endgame
#zelensky governmentukraine warubs reportbriccarbon dioxideclimate change denialcultural wardefund the policedepartment of justiceeconomic collapseel niñogeopolitical conflicthillary clintoniranisraeljerome corsijulian assangepolitical persecutionroger stone
26 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
How and Why U.S. Cities Are Destroying Themselves; America Losing Influence in the Middle East
#the coming global crash will create a historic gold rushsan francisco graffitiopen society foundationaction center on race and economybrandon johnsonbricscommercial real estate crisiscultural maoismdebt ceiling agreementezekielfirst we get the moneygeorge sorosglobal economic collapsegold price predictionjerome corsimahdimiddle east geopoliticsnuclear weapons proliferation
25 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Economic Chaos Leading to a Gold Rush? Another EU Nation Turns on Green New Deal
#swiss americareligious fundamentalismnuclear energy policyclimate change denialclimate change hoaxdean heskindecision technologiesdonald trumpdr jerome corsieric smithfinland nuclear power plantgold price predictionsgreen new dealgreen new deal critiqueinternal combustion enginesjoe bidenmutual fund analysisneo marxism
24 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukraine Can Not Win; Yellen Warns Over Debt Ceiling; Inflation Woes Continue
#viktor pinchukviktor orbánukraine warcarbon 60climate change denialdebt ceiling crisiseconomic distressenergy securityfederal reservejanet yellenjerome corsijulian assangemueller investigationmy vital cnorway oil explorationoffshore wind farmspodesta emailsstagflation fears
23 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Are More Bank Failures and a Housing Bust on the Way?
#woke culturewater vaporukraine warbakhmutcarbon dioxideclimate changeeconomic crisisfederal reservegeopolitical conflicthouston developerjamie dimonjerome corsipapo cate petipolitical polarizationsilicon valley banksolar irradiancetim scott
22 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Pushing Back vs the WHO Global Governance Power Grab; Bakhmut Falls
#zambiaworld health organizationwagner groupbakhmutbelt and road initiativechina us relationsclimate change policyexxonfinland nuclear powerglobal debt crisishillary clintonjerome corsikenyamarxism critiquemichelle obamapakistanrinat akhmetovrussia ukraine warsri lanka
19 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukraine Preps Allies for Disappointment; Debt, Inflation Burying U.S. Middle Class
#world war threewoke cultureukraine warbricschinachina ambitionsclimate changecryptocurrency regulationdurham reporteconomic inflationglobal escalationgold and silveriranjerome corsimicaneo marxismpresident bidenrussia
18 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
US Power Grid at Elevated Risk; Credit Card Debt Close to $1 Trillion
#zola levitt ministrieswind energysolar energycloward piven strategydebt ceilingdrug usedurham reporteconomic crisisfbigeopolitical conflictinternational renewable energy agencyjerome corsimarijuanamedicarenercnuclear powerpolitical corruptionrenewable energysocial security
17 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why Climate Change Zealots Ignore Clean Nuclear Energy
#vladimir yanukovychukraine conflictrobert oppenheimeranti capitalismantonio gramscicarbon dioxideclimate changecultural marxismelectric vehicleseuropean unionfrankfurt schooljerome corsijohn kerrymaidan revolutionnitrous oxidenuclear energyoliver stonepresident zelensky
16 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Durham Report Confirms What We All Knew with LTC Tony Shaffer
#western interferencevictoria nulandukrainebarack obamaclimate change denialdonald trumpdurham reportfbigeorge soroshillary clintonjerome corsijoe bidenmilankovitch cyclesnatonato expansionproject sentinelrussiarussia ukraine wartony schaffer
15 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Will Biden Administration Foreign Policy Lead Us Into WWIII?
#volodymyr zelenskyunemployment benefitsukraine warclimate change denialcredit card debtdemocratic primaryeconomic recessiongates institutegerman arms packagehillary clintonipcciran nuclear programjerome corsijoe bidennatoneo marxistrobert f kennedy jrrussiathe truth central
12 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Global Food Supply is At Risk; Chaos After Title 42 Expires
#will happerukraine conflictukraineclimate change skepticismcloward piven strategyfood supply securitygreen movementimmigration policyjerome corsimacmillan agencymaidan revolutionmarxist agendanitrogen fertilizerrichard lindzenrussian oligarch assetsswiss americathe truth centraltitle 42
11 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Post-Title 42 Migrant Influx is Coming and the Left's War on Appliances Continues
#zelenskyvladimir putinukraine warasylum seekersclimate change denialcommercial real estatecore cpiepa regulationseuropean commercial real estatefederal reserveimmigration policyinflation and interest ratesintergovernmental panel on climate changemichael mannneo marxist agendanuclear escalationquantitative easingtitle 42
10 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Russia Wants to Block Ukraine's Access to Black Sea, US Real Estate Crisis Mounts
#union bank towerukraine black sea grain exportsstrategic alliances2008 subprime mortgage collapsechinese supportclimate change debatecommercial real estate crisisdr david mantekglobal food securityhouston office towersintergovernmental panel on climate changeipcciranian revolutionary guardjfk assassination conspiracyjfk assassination x rayslee harvey oswaldneo marxist narrativeschool book depositorystrait of hormuz
09 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Reparations, Fiat Currency, Wind Turbines, EVs: The Math Does Not Add Up
#swiss americasaudi arabiaobamaaleksandr solzhenitsynbarbara leebidenbricscalifornia reparationsclimate changecritical theoryeconomic collapseelectric vehiclesepagovernor newsomhillary clintoniranjerome corsimatt mcmillanmockingbird project
08 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Thousands of US Banks are Potentially Insolvent; California Defaults on Debt
#zaporizhia nuclear plantukraine warthetruthcentralbanking crisiscalifornia debt defaultcarbon 60climate change policyeconomic collapsefdicfiscal irresponsibilityjerome corsijp morganmalthusian depopulationmatt mcmillanneo marxismsilicon valley bankswiss america
05 May
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Massive Layoffs Coming and the End of Cheap Airline Flights
#shopifyrussia ukraine warquantitative easingcarbon taxeconomic recessionepaeuropean central bankgeopolitical conflictgoldman sachsgreen energy transitioninflation hedgingjerome corsijoe bidenmetamodern monetary theorymonetary policy
04 May
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
More Bank Trouble, Fed Rate Hike Ripple Effects and Swiss Kids Pushed to Eat Insects
#volodymyr zelenskyvladimir putinswitzerlandbanking crisisbricsclimate change policycommercial real estatecultural marxismeurozonefederal reservegeopolitical conflictjerome powelljoe bidenmonetary policyneo marxismpacwest bankrussia ukraine war
03 May
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Push for Net-Zero Emissions is Not Based in Reality; Regional Banks' Stocks Falling
#western alliancethe truth centralsynovus financial corpchinacomericadr jerome corsieconomic recessionfederal reservegeopolitical conflictgreen energy transitionjohn williamskey corpmarxist ideologynet zero emissionsnordstrompacwestrussia ukraine warshadowstatscomsolyndrastagflation
02 May
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the 2023 Bank Crash is Worse than 2008; The Return of the North American Union
#solyndranorth american unionjpmorgan chasebanking crisisbengtssonbricsbrics expansionclimate change skepticismdebt ceilingde dollarizationesg investingfdicfederal debtfirst republic bankgold backed currenciesipccjerome corsi
01 May
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
First Republic Fallout; Fed Ponders Rate Hikes; Stagflation Around the Bend
#washington mutualvital cukraine warbank failuresbiden administrationclimate change debatecommercial real estatederivatives marketeconomic downturnelectric vehiclesfdicfirst republic bankinterest rate riskjerome corsijpmorgan chaseneo marxistsobama administrationopecrare earth minerals
2023 - April (20)
28 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Why the Gradual Global Financial Collapse Could Turn Into a Crash
#xrpthe last generationswiss americaantonio gramscicentral bank digital currencyclimate policycloward piven strategycritical theorycultural maoismeconomic collapseeuropean union carbon taxfederal reservefednowfinancial sovereigntyfrankfurt schooljerome corsimodern monetary theoryneo marxism
27 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Biden Crime Family Story is Not Going Away; Poland and Italy Stand Up to EU Power Grab
#world economic forumviktor orbanrobert f kennedy jrbill gatescapitalismclimate changedonald trumpeconomic collapseenergy policyfirst republic bankgiorgia meloniglobalismjerome corsijoe bidenklaus schwabmanhattan institutemark mills
26 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
BRICS Buying Gold and More Nations Want In While West Worries About Climate Change
#xrpwagner groupus economic declinebiden administrationbricsbrics expansionchevy boltclimate change denialenergy policy critiqueeu offshore wind farmgary genslergeneral motorsgeopolitical conflictjerome corsisecthe truth centralukraine war
25 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Fallout From the Carlson, Lemon Media Shakeup; Biden Announces Re-Election Bid
#tucker carlsonsusan ricerobert kennedy jrclimate change denialcultural maoismdemocratic partydon lemoneconomic declinefirst republic bankgavin newsomjoe bidenmedia censorshipmichelle obamaneo marxismpresidential elections
24 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ukraine Wants Endless Streams of Military Aid; BRICS Continue to Undermine Dollar
#wagner groupukraine warthe truth centralandrei melnykbakhmutbricsbureau of labor statisticsclimate change denialde dollarizationeconomic crisishunter bideninflation reduction actjerome corsimichelle obamanato expansionswiss america
21 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Ex-CIA Chief Confesses to Fake Hunter Laptop Letter; Economic Data Point to a Coming Recession
#zero hedgestagflationpresidential investigationsantony blinkenconference boardeconomic recessionfederal reservefederal reserve policygoldman sachsgreen energy transitiongreen movementhousing market crashhunter bidenhunter biden laptopjoe bidenmica regulationmike morrellnew york post
20 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Biden to Punish Good-Credit Homebuyers; Climate Change Zealots Attack Rice
#world economic forumunaidsrobert kennedy jrbiden administrationclimate change hoaxeminent domain abuseglobal governance critiqueharrison brownincome redistributioninternational commission of juristsjerome corsiminor attracted personsnet zero emissionspaul ehrlichpedophilia decriminalizationproject sentinel
19 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Looming Global Debt Catastrophe
#truth centralstephen jenstagflationaccenturebanking system instabilitybrookfield asset managementcommercial real estate collapsecommercial real estate debtde dollarizationdollar smile theoryernst and youngglobal economic crisisgoldman sachsgreen energy policyinflation reduction actjerome corsimckinseymoodysmorgan stanleyregional bankssolyndra
18 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Riots in Blue Cities; The Petroyuan on the Rise
#washington postukraine warukraine grain importsbakhmutclimate changeelectric vehicleseurodollar systemeuropean unionfischer tropsch synthesisglobal governancegreen movementgulf cooperation councilhungaryjerome corsilondon gold poolpetrodollarpetro yuanpoland
17 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Federal Reserve is Bankrupt
#world economic forumukraine warthe truth centralcarbon 60china populationcommercial real estatedemographic shiftseconomic recessionfederal reservefederal reserve policygeopolitical conflictgreat resetindia populationinflation crisisjerome corsim2 money supplyponzi schemetaiwan conflict
14 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Kremlin, NATO, Fight for the Black Sea Area; Oil Rises Again
#ukrainetruth centralsolyndrabiden administrationbureau of labor statisticsclimate changedepartment of justicedonald trumpeconomic policyepa mandatefederal reserveinflationinternational energy agencyjerome corsinatonato expansionneo marxismoil pricesopec
13 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The UN Seeks New Global Powers; Biden Doubles Down on EV Mandates
#world economic forumwall street journalstagflationbernie madoffbiden administrationbill gatesclimate change denialeconomic stagflationelectric vehiclesepa mandatefederal reservefordglobal governanceinflation reduction actnatorussia ukraine conflictrussia ukraine war
12 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Globalists Make Bold Moves: Unicoin and a Digital ID System
#xrpuniversal monetary unitsilicon valley bankbanking crisisbiden administrationcentral bank digital currencyclimate change policyeminent domaingovernment surveillanceimproving the digital identity act of 2023international monetary fundjamie dimonjanet yellenjerome corsikelo v new londonkirsten sinemarussia ukraine war
11 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Big Bank CEO Wants Private Property Seized for Climate Agenda - The Truth Central
#the truth centraltennessee goldnew york timesbiden administrationclimate change policycritical race theorydaniel greenfielddr benny pizereconomic inequalityelectric vehiclesfront page magazinegovernment overreachjamie dimonjerome corsijp morgan chasekarine jean pierremark moranomarxist critique
10 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Nuclear Energy's Future and Is Commercial Real Estate the Next to Fall?
#ukrainethe truth centraltaiwancarbon 60china us relationsdarien gapeconomic declineglobal conflictgold standardgordon changhamashezbollahhong kongisraeljerome corsikevin mccarthymitch mcconnellreligious prophecyrussia ukraine warswiss america
07 Apr
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Censorship, Disinformation and 5th Generation Warfare
#unrestricted warfarethe shroud codexswiss americacentral bank digital currenciesclimate change denialdiscerntvdisinformation campaignsedward bernaysepoch timesfifth generation warfaregeneral gerasimovgeorge sorosjean baudrillardjerome corsiorange revolutionpostmodernismrand institutesimulacra and simulation
06 Apr
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
As the Dollar and US Economy are Crumbling, Biden and Yellen Double Down on Climate Hysteria
#water vaporwalking liberty half dollarsshanghai cooperation organizationbiden administrationclimate change policyeconomic stabilityfederal reservegeopoliticsjanet yellenjerome corsijohn holdrenmalthusian movementneo marxismnet zero transitionpaul ehrlich
05 Apr
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Global De-Dollarization is Accelerating
#xrpwalking liberty half dollarsthetruthcentralcombiden administrationbric economic blocbric nationscentral bank digital currenciescoronal mass ejectionsglobal de dollarizationgold price forecastjerome corsikenyan shillingsopec pluspetrodollar systemsec lawsuitsshanghai cooperation organizationstagflation risksswiss america
04 Apr
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Oil to Hit $100? Gold to Reach $2000? Finland to Join NATO
#xrpwall streetvladimir putinchinacryptocurrency regulationfinlandgetlongevitymedscomgold investmentjerome corsimetforminmyvitalcnatonato expansionoil market manipulationopecrussiarussia china alliancesecswiss americaus economic decline
03 Apr
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Jerome Corsi Podcast Project
#vladimir putinstagflationsilicon valley bankesg investmentsfederal reservegeopolitical shiftglobal recessiongold standardgreen agenda critiqueinflation crisisjerome corsimcdonaldsmodern monetary theoryneo marxistsnouriel roubinioil price surgeopec
2023 - March (6)
31 Mar
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Jerome Corsi on Trump's Indictment; The Coming Decline of the U.S. Dollar
#zoltan pozarthe great awakening trilogystormy danielsbinancebretton woods 3cftccryptocurrency regulationdonald trumpeconomic collapseftxglobal reserve currencyjerome corsijoe bidenjulian assangemanhattan prosecutorsmueller investigationneo marxismpolitical prosecutionsec
30 Mar
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Truth Central - France Paying for Oil in Yuan; US Mortgage Industry in Danger
#yuanxrpus dollarbretton woods agreementbretton woods collapsechinacultural maoismdollar hegemonyeconomic recessionfinancial censorshipfrancegeopolitical alliancesiran nuclear programjerome corsineo marxismsaudi arabiastellarswift systemthe truth central
29 Mar
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Nuclear Energy's Future and Is Commercial Real Estate the Next to Fall?
#woke secular propagandathe truth centralswiss americacarbon 60central bank digital currencychris burryclimate change denialcommercial real estatedean heskineconomic collapseenergy policyjerome corsimalthusian goalsmodern monetary theorymy vital cnew world order
28 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
20230328_Tue_v2clkh8.mp4
#woke agendawater vaporunited nationscarbon dioxideclimate changeeconomic policyelectric vehiclesgas stovesgreenhouse gaseshydrocarbon fuelsintergovernmental panel on climate changeipccipcc reportjerome corsimalthusian communist agendarobert mueller
28 Mar
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Climate Change Alarmism and Will There Only Be a Few Banks Left Standing Soon?
#washington postsocial credit scoringsilent no more2008 financial crisisbanking instabilitycentral bank digital currencyclimate change denialclimate doomersfiat currency collapsegold and silvergreat awakeninghockey stick graphipccjerome corsijimmy cartermalthusian agendamichael mannneo marxismrobert mueller
27 Mar
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
The Banking Crisis, Inflation, Ukraine and the Coming Recession
#ukraine warthe gateway punditsilicon valley bankamerican thinkercentral bank digital currenciesclimate changeconspiracy theoriescredit suissecryptocurrencydonald trumpeconomic crisisfederal reservegeopoliticsgeorge sorosjerome corsimaidan revolutionmitch mcconnellmueller investigation
2021
2021 - January (11)
18 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Mrs. Monica Corsi Discusses Plans for the Future: 01-18-21
#website transitiontelemed servicesswiss america projectscorsi nationdrcorsicomdr gorskiebooksmedia evolutionmonica corsipodcast retirementpolitical commentarysigned autographs
18 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 01/18/21: A New Chapter Begins Now
#tele md programswiss americashroud of turincorsi nationde platformingdrcorsicomfinancial serviceshydroxychloroquinejerome corsikennedy assassinationmartin luther king jrmedia transitionpolitical strategyreligious beliefs
07 Jan
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-07-21: Inventing the Future
#swiss americashroud of turinreligious fundamentalismamerica for saleantifaconspiracy theoriescorsinationcomdominion voting systemsdonald trumpdulles brotherseconomic collapseelection integrityjerome corsijfk assassinationlyndon b johnsonmike pencepolitical polarization
06 Jan
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-06-21: Trump Will Continue the Fight
#yi jianmingvice president pencemike penceantifablack lives matterbohai harvest investment groupconstitutional crisisdominion voting systemsdonald trumpelection fraud claimselectoral count actelectoral count act of 1887hunter bidenjanuary 6 insurrectionjerome corsijoe bidenkristi noem
05 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi SPECIAL BROADCAST 01-05-21: Trump Prepares To Go To WAR!
#wisconsinpolitical polarizationpennsylvaniaantifabiden familyblack lives matterchina conspiracychuck grassleydominion voting machinesdominion voting systemsdonald trumpelection fraudgeneral michael flynngeorge soroshunter bidenjanuary 6 insurrectionjerome corsimark zuckerbergmike pence
05 Jan
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-05-21: Trump MAGA Supporters Head to DC in Millions
#voter suppressionspiritual warfaremike penceantifaantifa activismblack lives matterdominion voting systemsdonald trumpdr jerome corsielection fraudgeorgia electionjames okeefejanuary 6 insurrectionjoe bidenjohn macarthurjosh hawleykimberly parker
04 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE INTERVIEW 01-04-21: Attorney Ivan Raiklin Explains Trump's Legal Path to Victory
#vice presidential authorityted cruzmike pence12th amendmentantifaarticle 2 section 1black lives matterbrad raffenspergerchinadonald trumpelection fraud claimselectoral college disputeforeign interference allegationsivan raiklinjanuary 6january 6 joint sessionjoe bidenjosh hawleykamala harris
04 Jan
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-04-21: How Trump Will Win with an Electoral Commission on Jan. 6
#washington postvice presidentstacey abrams2020 election fraud25th amendmentchina dailyconstitutional crisisdeep state conspiracydonald trumpelectoral commissiongeorgia electionjanuary 6thjanuary 6th insurrectionjoe bidenkamala harrismike pencereligious fundamentalism
03 Jan
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 01-03-21: Pence Makes Decisive Move to Support Trump Win
#qanon narrativesnancy pelosimitt romneydominion voting systemsdonald trumpelection fraud claimselite capture theoryevery legal voteexecutive order 13848foreign interferenceiranjanuary 6 insurrectionjoe bidenjovan pulitzerjulian assangekamala harrismaga partymike pencemitch mcconnell
02 Jan
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-02-21: The Strategy for Pelosi to Lose Her Job as Speaker of the House
#vernon jonesreligious fundamentalismprayerful patriot12th amendmentantifaconspiracy theoriesdominion voting systemsdonald trumpelection fraudfourth reichfulton countygeorgia electionjanuary 6th insurrectionjoseph corsimike pencenancy pelosipolitical polarization
01 Jan
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 01-01-21: The New Year Starts With Trump Win
#voter fraud claimssupreme courtreligious nationalism12th amendmentbill de blasioconstitutional crisisdepartment of justicedominion voting systemsdonald trumpelectoral integrityfbijanuary 6jerome corsimaga partymike pencemitch mcconnellpolitical polarization
2020
2020 - December (33)
31 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-31-20: Case Closed - Georgia Gives OK to Determine Fraud
#voter suppressionsection 230rudy giuliani2020 election fraudanthony faucibrad raffenspergerchinese communist partycovid 19 treatmentsdominion voting systemsdonald trumpjeffrey epsteinjerome corsijohn robertsjosh hawleymaga movementmike pencemitch mcconnellpolitical conspiracy theories
30 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi NEWS 12-30-20: Pence Steps Up for Endgame of 2020 Election
#vladimir zelenkonancy pelosimitch mcconnell12th amendment22nd amendmentbarack obamachina corruptionconstitutional crisisdominion voting machinesdonald trumpedward foleyelection fraudelectoral count act of 1877hunter bidenjanuary 6john williamsmike pence
29 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-29-20: Trump Gains as Ukraine Fingers Biden Family
#sidney powellroman republicpolitical corruptionanthony fauciburisma holdingsconstitutional partycovid 19 conspiracydonald trumpelection fraudhunter bidenjanuary 6thjoe bidenjohn robertsjosef baruch gelfandjudy mikovitzmedia censorshipnew declaration of freedom
28 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-28-20: The MAGA Party Demands a Second Term for President Trump
#wikileakssidney powellmike penceantifablack lives matterconspiracy theoriescovid 19donald trumpelection fraudfederal reservejanet yellenjanuary 6jerome corsijoe bidenjulian assangemaga movementmaga party
27 Dec
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST: 12-27-20 The Rise of the MAGA Party
#wuhan labvalley forgesidney powellantifaconspiracy theoriescovid 19dominion voting machineselection fraudfirst amendmentgeorge washingtonhunter bidenjerome corsijoshua marchmaga partypolitical polarizationqanonreligious nationalism
26 Dec
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-26-20: Trump Targets CCP Enemies in USA
#voter suppressionpatriots partynancy pelosianthony s corsichinese communist partychinese influencedeep statedeep state coupdianne feinsteindominion voting systemsdonald trumpelection fraudfalun gongjanuary 6 protestsmike pencemitch mcconnellmueller investigation
25 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig SHINE LIGHT ON DARKNESS 12-25-20: A Time For Both Spiritual & Political Choosing
#wuhanreligious extremismpandemic restrictions2020 electionbiden familychinaconspiracy theoriesdonald trumpdr vladimir zelenkoelection fraudhydroxychloroquinejohn robertsmail in votingmark milleymedia censorshipnursing home lockdownsoperation mockingbird
24 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-24-20: Trump Prepares End-Game Round Up of CCP Traitors in USA
#zach exleysidney powellrudy giulianichristopher millercommunist chinese partydeep state conspiracydonald trumpelection fraudforeign interferencejanuary 6th protestsjoe bidenjohn robertsjoseph corsimark milleymike pencemilitary loyaltymitch mcconnellpat cipollonered dog indictments
24 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-24-20: Patrick Byrne Explains Trump Path To Victory
#sidney powellrudy giulianireligious themeschinaconspiracy theoriesdominion voting machinesdonald trumpelection fraudgeorge washingtonjanuary 6jerome corsimark meadowsmedia censorshipmichael flynnpatrick byrnepolitical resistanceprayerful patriot
23 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-23-20: Biden LOSES as States Decertify Biden Fraudulent Win
#well grounded programsupreme court impeachmentsidney powell2020 election fraudbill binneycia corruptioncuban missile crisisdominion voting systemsdonald trumpdr jerome corsijeffrey zuckerjoe bidenjohn robertsjovan hutton pulitzernsa surveillanceoperation mockingbirdpatrick byrneruby freeman
22 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi NEWS 12-22-20: Trump Assembles His Christmas Victory Core Team
#trump administrationsmartmaticsidney powell2020 election fraudbill barrbill gatescovid 19 misinformationdominion voting systemsdonald trumperic swalwellexcommgeorge sorosgeorgia recountglobalist conspiracygreat resetjoe bidenjohn f kennedyruby freemanrudy giuliani
21 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-21-20: Trump Celebrates Christmas Victory over Biden
#vladimir putinsolarwindssidney powellchina influencedeep statedominion voting systemsdonald trumpelection fraudjerome corsijoe bidenkamala harrismitch mcconnellnight of the long knivespatrick byrnepolitical purgesrudy giulianirussian cyberattacks
19 Dec
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-19-20: Trump Shuts Down Biden Transition
#peter strzokmedia censorshipmagaantrim countyboris johnsonchristopher millercuban missile crisisdeep state conspiracydominion voting systemsdonald trumpelection integrityforeign interferencejerome corsijoe bidenjohn ratcliffejulian assange
18 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-18-20: BOOM! Trump Readies Emergency Declaration
#ubs securitiessupreme courtsolarwindsconspiracy theoriesdominion voting systemsdonald trumpelection fraudforeign interferencegoldman sachsguantanamo bayhunter bideninsurrection actjerome corsijohn ratcliffejohn robertsmilitary tribunalspatriot movement
17 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-17-20: The Kraken Hits SCOTUS Docket
#trump winssupreme courtsidney powell2020 electionandrew radcliffeconspiracy theoriesdominion voting systemsdonald trumpdr jerome corsielection fraudhillary clintonjoe bidenjohn robertskrakenpatrick byrneqanonrussell james ramsland
17 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-17-20: Evidence of Voter Fraud Mounts
#ted cruzsolarwindssidney powellbig tech censorshipconspiracy theoriesdeep state plotdi dongshengdominion voting systemelection fraudforeign interferencehunter bidenjanuary 6thjerome corsijoe bidenjohn ratcliffemark zuckerbergnew york postrudy giuliani
16 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-16-20: End Game - Biden Gets Caught
#vote counting irregularitiessolarwindssharpiegateconspiracy theoriesdominion voting systemsdonald trumpdr shiva ayyaduraielection fraudforeign interferencehunter bidenjack dorseyjoe bidenjulian assangemail in ballot corruptionmaricopa countymark zuckerbergmitch mcconnellrobert barrseth rich
15 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-15-20: Wray, Haspel, Milley - They ALL Must Go!
#william barrsupreme courtsolarwindschinadominion voting systemsdonald trumpelection fraudelectoral collegeelectoral college votesf 35 technologyforeign interferencehunter bidenjanuary 6th insurrectionjeffrey rosenjerome corsijoe bidenmartial law
14 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-14-20: Time To Fire Barr
#william barrrosemont senecamike haydenantrim countybohai harvestchina influenceconspiracy theoriesdana nesseldeep statedominion voting machinesdonald trumpelection fraudgeorge soroshunter bidenhunter biden laptopjerome corsijoe bidenjohn ratcliffematthew dipernomichael flynn
13 Dec
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-13-20: CHINA CHINA CHINA !
#william barrviktor shokinukraine scandalavicbank of chinabohai harvestburismacgnchina collusiondemocratic partyelection fraudhunter bidenhunter biden laptopjerome corsijoe bidenkolomoiskymalia obamamarie yovanovitchnational security
12 Dec
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-12-20: TRUMP STILL WINS!
#voter fraud claimssupreme courtspiritual warfare12th amendment25th amendmentantifaconstitutional lawdonald trumpelectoral collegehunter bidenjanuary 6th certificationjerome corsijoe bidenkamala harrismaxine watersmike pencesidney powell
11 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-11-20: Trump Winning At SCOTUS
#xi jinpingtexas v pennsylvaniapolitical polarizationact 77constitutional lawcsisdeep state conspiracydonald trumpelection integrityelectoral collegefourth reichgeorge sorosglobalismjerome corsijoe bidenjohn robertspennsylvania supreme court
10 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-10-20: Why SCOTUS Hears The Texas Case
#voting rights lawtexas casesupreme court jurisprudence2020 election fraudalan dershowitzbush v goreconstitutional interpretationconstitution partydominion voting systemsdr corsigeorge hw bushgeorge w bushharriet miershunter bidenjohn robertslarry litwinpolitical corruption
09 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-09-20: SCOTUS Takes The Case
#texas v pennsylvaniated cruzsupreme court jurisdictionamy coney barrettbush v goredominion systemselection fraud allegationselectoral collegeelectors clausegematriageorgia senate runoffilluminatimcpherson v blackermitch mcconnellnancy pelosirudy giulianiruth bader ginsburgsidney powellstate legislative authority
08 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-08-20: Corsi Files Corsi v Biden at SCOTUS
#william barrshay freemanruby freeman14th amendmentarchangel michaelbrian kempconspiracy theoriescorsi v bidendominion voting systemselection fraudelectors clauseforeign interferencegreat resetmueller investigationnew world order
07 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr. Corsi SPECIAL BROADCAST: Is A Revolution Inevitable?
#supreme courtsheriff joe arpaiosecond amendment14th amendmentbundy familycorsi v bidendeep statedominion voting systemelection fraudelectoral collegegeorgia senateharry reidjerome corsijudge emmett sullivanlarry klaymanmichael flynnpolitical revolution
07 Dec
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-07-20: Trump Will Win At SCOTUS
#william barrstate legislative powersidney powellalan dershowitzbarack obamachristopher wraycorsi v bidencraig cormickdeep state conspiracydominion voting systemsdonald trumpedison researchelection irregularitiesjoe bidenlarry tribelawfare tacticsmichael corsipolitical couprobert mueller
06 Dec
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-06-20: How Trump Defeats Lawfare
#wisconsinsupreme court petitionsidney powellabbott v perezbarack obamaconstitutional crisiscraigdonald trumpedward foleyelection fraud claimselectoral collegegeorge sorosgeorgiajerome corsilawfare strategymichigannancy pelosipennsylvaniarudy giuliani
05 Dec
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-05-20: TO WIN TRUMP MUST GAME LAWFARE TIMETABLE
#nancy pelosimike pencelawfarealan dershowitzamistad projectchinese communist partyconstitutional crisisdonald trumpdr zelenkoedward foleyelection fraudelectoral count actelizabeth warrenjanuary 6 insurrectionjerome corsijia wujoe bidenlarry tribe
04 Dec
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-04-20: Corsi Files Petition At SCOTUS
#sidney powellrudy giulianipsyop2020 election fraudbarack obamabrad raffenspergerbrian kempconspiracy theoriesdonald trumpelectoral college disputefulton countyhillary clintonjeff zuckerjerome corsimail in ballot controversyoperation mockingbirdpolitical polarization
03 Dec
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-03-20: Trump Goes to SCOTUS
#trump winstcf centersidney powellabbott v perezbill barrconstitutional lawdonald trumpelection fraudelectoral collegefinancial independenceglobalismhunter bidenjerome corsimedia censorshiprudy giuliani
02 Dec
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-02-20: Trump Gains Ground Proving Fraud
#william barrsupreme courtsidney powellabbott v perezantifabush v goreconstitutional rightsdeep statedonald trumpelection fraudelectoral collegejeremiah 20 11jesse morganjoe bidenjohn durhamroman catholic diocese of brooklyn v cuomorudy giuliani
01 Dec
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 12-01-20: How Trump Wins
#supreme court strategystate legislature powersidney powellarticle 2barack obamabush v goreconspiracy theoriesdepartment of justicedominion voting systemselection fraudelectoral collegeimmigration policyjericho marchesjerome corsimcpherson v blackerprescott bushrudy giuliani
2020 - November (28)
30 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-30-20: New eBook TRUMP WINS! 100% Certain
#trump winssupreme court strategyprayerful patriot2020 election fraudalan dershowitzantifaarticle iiblack lives matterbush v goreconstitutional lawdeep state conspiracydonald trumpjerome corsijoe bidenkamala harrislawfaremail in voting
28 Nov
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig RECAP Corsi Nation Broadcasting for the Week of 11-23-20 - 11-25-20
#voter suppressiontom wolfstate legislatorsbrad raffenspergerdeep state conspiracydominion voting systemsdoug mastrianoelection fraudelectoral collegegeorgia governor kempgettysburgjenna ellislegal challengesmichael flynnpennsylvania supreme courtpicketts chargerobtexrudy giulianisidney powellspiderfoot
25 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-25-20: Trump Has Winning SCOTUS Strategy
#swiss americastate legislature authoritysidney powellabbott v perezarticle twoconstitutional crisisdominion voting machinesdonald trumpelection fraud claimsjericho marchjerome corsijohn robertslegal strategyliberation theologymodern monetary theorypolitical extremismrudy giuliani
24 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 11-24-20: 2020 Election and Voter Fraud Exposed
#voting system securitysmartmaticseidel2020 election fraudbexar countycisaclarity electionscybersecurity vulnerabilitiesdallas countydominion voting systemsdonald trumpelection integrityesandsfbigovernment responsehelp americans vote actjerome corsimatt bevinrussell ramsland
24 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-24-20: Trump - The Best Is Yet To Come
#russ ramslandpolitical polarizationnostradamusaocciaconspiracy theoriesdallas election data reviewdepartment of justicedominion voting systemsdonald trumpelection fraudelectoral collegehelp america vote acthydroxychloroquinejerome corsikamala harrisnist
23 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-23-20: Trump Corners on Victory
#world health organizationvoter suppressiontucker carlson25th amendmentconspiracy theoriesdominion voting systemsdonald trumpelection fraudgeorge sorosglobalismjericho marchjerome corsinsaoperation mockingbirdpolitical corruptionsidney powelltedros adhanom ghebreyesus
21 Nov
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig RECAP Corsi Nation Broadcasting for the Week of 11-16-20 - 11-20-20
#voter suppressiontucker carlsontrumpettoday2020 election fraudandrew weissmanbarack obamaclarence thomasdeep state conspiracydominion voting systemsenron scandalgeorge soroshillary clintonhydroxychloroquinejack dorseyjohn robertsmedia censorshiprudy giulianisidney powellspiritual warfare
20 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-20-20: Trump Is The Kraken
#wuhan virustucker carlsontedros25th amendmentconspiracy theoriesdominion voting machinesdonald trumpelection fraudfourth reichgeorge sorosglobalist cabalinsurrection actjericho marchjerome corsipolitical censorshipsidney powell
19 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-19-20: Joshua's Trumpet Sounds Victory for Trump
#wayne county board of canvasserstrumpet todaysidney powellalan dershowitzanti communist rhetoricchristopher millerconstitutional authoritydominion voting systemsdonald trumpelection integrityezra cohen watnickforeign policyimperial presidencyjerome corsimark espermichael flynnoperation mockingbirdreligious nationalismrudy giuliani
18 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-18-20: Trump Grandmasters End Game
#yad vashemwilliam hartmanwayne county canvassers2020 election fraudalan dershowitzbull connordemocratic conspiracyhydroxychloroquineisrael iran conflictjerome corsikamala harrismarxist revolutionmonica palmernew world ordersidney powellstate legislature strategyswiss americatrumpet
17 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-17-20: Trump Releases the Kraken
#supreme courtsidney powellreligious rhetoricantifabill gatesblack lives matterconspiracy theoriesdominion voting systemsdonald trumpelection fraudgina haspelhunter bidenjack dorseyjericho marchesjoe bidenjohn robertspolitical extremism
16 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-16-20: Trump Will Win BIGLY!
#voter suppressiontrump blackstate legislature powerallen dullesconspiracy theoriesdominion voting systemselection fraudgeorge sorosjericho marchesjerome corsimedia censorshipmike pencenancy pelosipeter neffingerrob weaversidney powellsmartmatic
15 Nov
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig RECAP Corsi Nation Broadcasting for the Week of 11-09-20 - 11-13-20
#trumpettodaytrey traynorthedonaldwin2020 election fraudamericas voicedemocratic partydominion voting systemsdonald trumpelection subversiongeneral michael flynnjericho marchjoe bidenlegal challengesrudy giulianisidney powellspiritual warfare
13 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-13-20: FEC - 2020 Presidential Election Is Illegitimate
#voter suppressionvenezuelatwitter2020 election fraudchinadominion systemsdominion voting systemsdonald trumpfacebookjoe bidenlegal challengesmichiganpam bondipennsylvaniarick grinellrudy giulianisidney powellsocial media censorshiptrey traynor
12 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-12-20: Trump Legal Team Proves Voter Fraud
#trumpettodaysupreme court rulingsstate legislature power2020 electionamy coney barrettconspiracy theoriescorsinationcomdominion voting systemselection fraudjack dorseyjericho march 20mark zuckerbergmelissa caronnancy pelosipolitical protestsrob weaverron klainrudy giulianisamuel alito
11 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-11-20: Biden Loses GA, Now Under 270
#voter fraudtrumpettodaysupreme court2020 electionamy coney barrettandrew setobush v gorecraig cormickdonald trumpelectoral collegehunter bidenjericho march 20joe bidenmedia censorshiprichard hopkinsrudy giulianisidney powellstephen k bannon
10 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-10-20: Trump Wins Going on Offense
#william barrtrumpetreligious extremism2020 election fraudbush v goreconstitutional lawdeath valleydonald trumpelectoral collegeinsurrection actjericho march 20jerome corsijoe bidenmaiden gatemaricopa countymark esperpennsylvania supreme courtpolitical conspiracy theoriesq movement
09 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 11-09-20: Mathematical Anomalies of 2020 Election Results
#wayne countyvoter registration integritynancy pelosi14th amendment2020 election fraudantrim countydavid harris jrdominion voting systemselection administrationelectoral college processelectronic registration information centerfisa courtjerome corsikevin wadelexisnexismueller report
09 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-09-20: Trump Wins Endgame
#voter suppressionvirginiapolitical polarizationamy coney barrettbush v goreciaconstitutional lawdaniel 5 21department of justicedonald trumpelection fraudgeorgiajerome corsijoe bidenkyle foxmedia censorshipmichiganpennsylvania
08 Nov
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig RECAP Corsi Nation Broadcasting for the Week of 11-02-20 - 11-06-20
#supreme court interventionsidney powellrick grinell2020 election fraudbush v goredonald trumpdr corsidr faucielectoral collegefox newsgovernor cuomojoe bidenkamala harrismail in ballot controversymainstream media biasnixon concessionorange county electionpam bondiq movement
06 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 11-05-20: Defeating Voter Fraud to Maintain Voter Integrity
#william koenigsupreme court interventionstate legislature authority2020 election fraudaaron zielinskiamy coney barrettbarr probebush v gorechris kobachdonald trumpdr carla dean gravesdurham probeelection lawfarejeannie rheejerome corsijoe bidenjohn robertsmail in ballot irregularitiesruth bader ginsburg
06 Nov
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-06-20: Trump Wins Exposing the Coup
#william barrvoter fraudmedia censorship2020 electionamy coney barrettbush v gorecarlos slimchristopher wrayconstitutional lawdonald trumpgeorge sorosjack dorseyjanuary 6jeff bezosjerome corsijoe bidenjohn robertsmark zuckerberg
05 Nov
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-05-20: Trump is On Track to Win Re-election
#voter fraudsteve bannonsidney powell2020 electionalexander hamiltonbush v goreconstitutional lawdonald trumpelectoral collegeinsurrection actjames okeefejerome corsijoe bidenmaidan rebellionpolitical conspiracyproject veritasrudy giuliani
04 Nov
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-04-20 Why DEMs Will Not Succeed in Stealing Election
#zincxi jinpingtelemdamy coney barrettchina us relationscovid 19 treatmentsdonald trumpdr zelenkoelection fraudhunter bidenhydroxychloroquinejerome corsijoe bidenmail in ballotssupreme courttaiwan
03 Nov
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-03-20: Trump Surges as Biden Fades
#wick pollingvoter suppressionreligious nationalismchoose democracycoast to coast amdevon archerdonald trumpelection fraudgovernment subversiongreen new dealhold the linehunter bidenjerome corsijoe bidenmedicare for allpolitical polarizationpsalm 27
02 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig Shine Light On Darkness 11-02-20: Prayer for the Saving of America
#voter suppressionvoter fraudreligious extremism2020 electionantifaarthurballot harvestingblack lives matterblack magicconspiracy theoriescraigdonald trumpjohn 14 14mail in ballotsmatthew 18 18 18 20political violenceportland oregon
02 Nov
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 11-02-20: Biden Campaign Implodes
#xi jinpingthe little red book of democrat socialist liesstephen k bannon2020 us electionamerica for salebarack obamachina influencecommunist conspiracycraigcultural marxismdavos global economic forumdonald trumpgreat resetheart peace projecthunter bidenhunter biden scandaljerome corsijoe bidenkamala harris
01 Nov
Sun
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Arthur & Craig RECAP Corsi Nation Broadcasting for the Week of 10-26-20 - 10-31-20
#sean hannityproject veritasprayerful patriotanthony faucichristopher wrayconspiracy theoriesdonald trumpdr corsielection integritygeorge soroshunter bidenhydroxychloroquinejack dorseyjoe bidenmarie yovanovitchmedical freedompeter strzokpolitical corruption
2020 - October (16)
31 Oct
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-30-20 The Importance of Prayer for President Trump's Victory
#world economic forumspiritual warfarereligious freedom25th amendmentantifaarchbishop carlo maria viganòbastognebill gatesblack lives matterconspiracy theoriesdivine interventiondonald trumpelection integritygeneral pattongreat resetjoe bidenkamala harrispope francisprayerful patriot
30 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-30-20 - Larry Klayman's New Book It Takes a Revolution
#william kellersheldon whitehouserichard burrbell atlantic versus twomblycitizen revolutionclinton foundationconstitutional rightsdeep state theorydianne feinsteingloria navarroinsurrection actit takes a revolutionjerome corsijoe arpaiojudicial corruptionjudicial watchlarry klaymanmedia censorshipmichael avenatti
30 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-30-20: Biden Family Now Under Criminal Investigation
#voter suppressionthe prayer for patriotrudy giuliani25th amendmentchristopher wraydonald trumpdr jerome corsielection fraudhunter bidenhunter biden corruptionhunter biden laptopjack dorseyjoe bidenkamala harrislarry klaymanmark zuckerbergpolitical conspiracyreligious extremism
29 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS: Thurs Oct 29 Biden Campaign Collapses in Scandal
#voter fraudtwitter censorshiptwitterbarack obamaburismaconspiracy theoriesdevin archerdr faucidr zelenkoeconomic collapsehunter bidenhunter biden scandalhydroxychloroquinejack dorseyjerome corsijoe bidenmail in votingmark zuckerbergswiss americatony bobulinski
29 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr CVorsi DEEP DIVE Interview 10-28-20: Are Masks Necessary And Are They Harmful
#zincvitamin dvaccine censorshipcdccivil libertiescovid 19dr lee merrittdr neil fergusondr richard ursoface mask efficacyhydroxychloroquinen95 masksnew england journal of medicinenigeriapandemic mitigationpharmaceutical industryquercetinsurgical maskssweden
28 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-28-20: Hiden Biden Back In The Bunker
#voter suppressiontony bobulinskiswiss america22nd amendment25th amendmentantifabarack obamablack lives matterconspiracy theorieselection fraudgeorge soroshunter bidenhydroxychloroquinejerome corsijoe bidenmedia censorshippolitical coup
27 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-27-20: Polls Rigged to Protect Mail-in Voter Fraud
#supreme court confirmationrick grinnellmark zuckerbergamy coney barrettcovid 19 controversydeep state conspiracydevin nunesdonald trumpdr faucidr jerome corsidr zelenkoelection integritygeorge floydgeorge soroshunter bidenhunter biden laptopjack dorseyjoe biden
26 Oct
Mon
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-26-20: Biden Stays in the Cellar as Campaign Fails
#voter fraud allegationsspiritual warfareq movement2020 presidential electionamy coney barrettantifablack lives matterchina relationsdonald trumpdr zelenkogeorge soroshunter bidenhydroxychloroquinejack dorseyjoe bidenmark zuckerbergmedia censorship
24 Oct
Sat
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Craig & Arthur Recap Corsi Nation Broadcasting for the Week of 10-16-20 to 10-23-20
#rudy giulianireligious politicspolitical corruptionadam schiffamy coney barrettanthony faucibiden crime familybill gatesconspiracy theoriesdanielle dsouzadinesh dsouzadonald trumpdr vladimir zelenkogeorge soroshealthcare controversyhillary clintonhunter bidenjoe bidenmedia censorship
23 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-23-20: Trump Wins Last Debate
#us national debttony bobulinskisino hawkbelt and road initiativecefc china energycraig arthurdeep statedonald trumpfiat currencygold standardhunter bidenhunter biden laptopimfjerome corsijoe bidenleslie stahlobamacareruth bader ginsburg
23 Oct
Fri
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-22-20: Last Presidential Debate Tonight
#trump cardsocialismpresidential debateamerican valuesamy coney barrettbiden family corruptionciacnncritical race theorydeep statedinesh dsouzadisinformation campaigndr jerome corsihunter bidenjack dorseymark zuckerbergmsnbcnsa
22 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-22-20: Dinesh D'Souza New Movie Trump Card
#ulysses s granttrump cardstormy danielsabraham lincolnaccess hollywood tapeamerican dreamcivil war eradeep statedemocratic partydinesh dsouzahugo chavezilhan omarjerome corsimedia censorshipmichael flynnobama administrationroger stonesocialism
22 Oct
Thu
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-21-20: Evangelicals Under Attack
#trump administrationsupreme court appointmentsruth bader ginsburgabraham accordsamy coney barrettbarna groupblack lives mattercultural marxismcyrus the greatevangelical politicsgeorge soroshunter bidenisaiah 45israel palestine conflictjerome corsiobergefellreligious libertyroe v wade
21 Oct
Wed
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-21-20: Biden Bites the Dust
#world health organizationwalking liberty half dollarssteve bannonamy coney barrettcnncovid 19 conspiracy theoriesdonald trumpdr judy mikovitseconomic inflationhunter bidenhunter biden laptopjoe bidenjoe biden corruptionjohn kerrymark zuckerbergmedia censorshipmsnbcpelosi stimulus packagerudy giuliani
20 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-20-20: Danielle D'Souza Gill 's New Book - The Choice
#the choicestephen k bannonspiritual accountabilityabortion ethicsbuddhismconstitutional lawdanielle dsouza gilldaoismdinesh dsouzafetal developmentfreakonomicshinduismjerome corsimargaret sangermayo clinicplanned parenthoodsave the storks
20 Oct
Tue
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi
Dr Corsi NEWS 10-20-20: YouTube Censors CorsiNation
#youtube strikeworld health organizationvoting fraud allegationsabortion debateanthony fauciaocburismacovid 19 controversiesdanielle dsouza gilldr jerome corsielizabeth warrengeorge soroshunter biden laptophunter biden scandaljoe bidenjudicial watchmark zuckerbergmedia censorshippolitical conspiraciesproject veritassidney powell