« Back to Topics Overview
No selection means all shows.

jerome corsi

464 episodes

Filters
Date Range
06 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Venezuela, Ukraine, and the Global Reckoning
#zorah mamdanivladimir zelenskyvenezuela politicsabu khar dahirchristia freelandcommunist partydonald trumpelection integritygeorge sorosglobal debt crisisjerome corsijoe bidenmovement for black livesnicolás maduroopen society foundationsruckus societyukraine warus domestic politics
00:27:04
19 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
The Targeting of General Michael Flynn: Service, Sacrifice, and Retaliation
#sidney powellscott wiperrussian collusiondeep statedefense intelligence agencydepartment of justicedocumentary filmdonald trumpflynn the moviegeneral michael flynngovernment conspiracyjames clapperjerome corsijohn brennanmichael flynnobama administration
00:51:02
16 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
From Soviet Rule to DHS Target: One Man’s Story
#wassonpresident zelenskypolitical prosecutionbishopcraigslist advertisementcustoms and border patrolcustoms enforcementdepartment of homeland securitydimitri kudrindonald trumpfourth amendment rightsfraud indictmentgods 5 stonesgovernment overreachimmigrant entrepreneurshipjerome corsimike novaplea deal
00:50:23
01 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Zelensky Cornered: The Peace Deal and Ukraine Corruption Blows Open
#victoria nulandukraine warswalwellact blueandrew wolfeantifablack lives matterconspiracy theoriesdonald trumpdonbasseconomic collapsegeorge soroshydroxychloroquineimmigration policyjerome corsijudge boazbergmueller investigationpolitical corruptionsandra beckstromsenator clyburn
00:26:20
25 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
How Obama’s Deep State Took Over the Catholic Church
#theodore mccarrickpope francisoperation condor2020 electionalliance for prosperitycarlo maria viganòcatholic churchchild traffickingdeep statedennis mcdonoughjd vancejerome corsijoe bidenjohn f kellyjorge bergogliojuan orlando hernandezmike mccormick
00:54:52
20 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#social control mechanismsreligious educationrachel carsonbrian sussmancarbon taxcbsclimate change skepticismclimate cultdan ratherenvironmental movementfrederick engelsglobal warming scamgreen new dealjerome corsimarxist ideologymilgram experimentpaul ehrlich
01:03:06
10 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Shutdown Deal Revealed | Trump Pardons Shake Deep State
#zohran mamdaniwalking liberty half dollarvoter frauddemocratic partyeconomic crisiselection integrityforeign policygold pricesgovernment shutdownjerome corsijohn eastmanpelosireligious faithrudy giulianirussian missile attackschumertodd blanchetrump pardons
00:24:39
07 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
NYC Goes Socialist: Bezmenov’s Warning and What Zohran Mamdani’s Win Really Means
#zohran mamdaniyuri bezmenovvoter id lawscommunist subversioncourseynationdemocratic partydonald trumpdonbass regioneconomic declineelection integrityeugene v debsgreen energy policiesjerome corsikgbmarxist ideologysenate filibuster
00:34:32
23 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Trump Can Force an Endgame in the Ukraine-Russia War | Corsi Nation Breakdown
#zelenskyvladimir putinus national debtabraham accordsdeep statedonald trumpdonbasseconomic debtgold investmentjerome corsimedvedevnatonuclear deterrencerussia gatetomahawk missilesukraine russia war
00:13:46
21 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#x raysvietnam warthe assassination of john f kennedy the final analysisciaconspiracy theoriesdealey plazadeep statedr malcolm perryevalia glangesford motor companygeorge whitaker srjerome corsijfk assassinationjohn f kennedylee harvey oswaldnational archivesnick principerobert harrison
00:43:46
28 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
Mainstream Media in Denial Over Gabbard’s Russiagate Findings
#tulsi gabbardswiss americarussian collusionandrew paquettecarter pagechristopher steelecourseynationdonald trumpelection integrityfbi indictmentsforeign policygold investmentsjames clapperjerome corsijohn brennanlindsey grahamms 13
00:28:44
25 Jul
Fri
The Truth Centra...
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#warren reportthe final analysistexas school book depositoryboswellcia operationsconspiracy theoriesdearborn michigandeep statedouglas weldonford motor companygeorge whitaker srjames humesjerome corsijfk assassinationlee harvey oswaldmalcolm perrynational archivesrobert harrisonroy schaefer
00:43:46
24 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#solar radiation managementscientific integrityreligious awakeningbrian susmancarbon taxesclimate change denialclimate cultclimategatedan rathereco tyrannyenvironmental movementfrederick engelsgreen new dealjerome corsimarxist ideologypaul ehrlichrachel carson
01:00:01
15 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#sidney powellscott wiperrussiagatedeep statedirector of defense intelligence agencydonald trumpfbi indictmentflynn the movieforeign agent chargesgeneral michael flynngovernment overreachjerome corsimichael flynnmueller investigationmueller reportnational security advisorplea deal
00:51:22
10 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
The Epstein Files: The Truth Behind the Cover-Up
#voter fraudswiss americaprince andrew25th amendmentandrew paquettebarack obamabill clintonbricschristopher wrayconspiracy theoriescourseynationdan bonginodonald trumpelection integrityepstein caseforeign interferencehillary clintonjames comeyjerome corsijohn brennankash patelkeith kelloggking charlespam bondipeter titkin
00:41:29
30 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Why Iran Lost its War with Israel: The True Story
#tucker carlsonreligious extremismmiddle east conflictabraham accordsalex jonesayatollah khameneibelt and road initiativebenjamin netanyahuconspiracy theoriesdonald trumpeconomic policyelectoral integrityfederal reservegods five stoneshugo carvajal berriosjerome corsi
00:35:22
26 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
Report: Damage Done to Iran’s Nuclear Facilities “Massive”
#zohran mamdanius debtpolitical corruptionactbluedebbie wasserman schultzdonald trumpelection fraudesfahanfinancial crisisfordogary bernsteinhugo carvajalimmigration policyinstitute for science and international securityiran nuclear programjason jonesjerome corsinatans
00:36:48
24 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
The Iran-Israel Ceasefire: What Happens Next?
#trump administrationsupreme court rulingnatoabraham accordsb 2 bomberscourseynationdonald trumpeconomic crisisfordo plantgold and silverimmigration deportationisrael iran warjerome corsijoe bidenjohn kerrymiddle east policy
00:22:11
20 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
Iran: What Will Trump Do?
#zelenskyus foreign policytucker carlsonclinton familydonald trumpeconomic collapsefordowiranisraelisrael iran warjerome corsijimmy carterkhomeininuclear proliferationregime changesteve bannonswiss americatel aviv
00:29:54
19 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
Tucker vs. Cruz: Who Was Right About Dealing with Iran?
#tucker carlsonted cruzrussiagate9 11abortion rightsayatollah khomeiniconspiracy theoriesdonald trumpeconomic collapsefederal reserveiranisraelisrael iran conflictjerome corsijfk assassinationnuclear proliferationregime changeroe v wade
00:33:08
18 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
The CCP Election Interference Scheme’s Deep State Connection
#voter id requirementstranshumanismtony blinken2020 election fraud25th amendmentayatollah khameneibill burnschina influence operationscisacritical race theorygold standard economicshunter bideniran israel conflictjanuary 6thjanuary 6th insurrectionjerome corsikash patelnancy pelositom grassley
00:35:31
17 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
A CCP Plan to Create Fake Mail-In Ballots Exposed?
#ukraineswiss americamarkham2020 election9 11 attackschristopher wraycommunist party of chinaconspiracy theoriesdonald trumpelection integrityfinancial crisisforeign interferenceg7 meetingglobalismgold pricesiranjeffrey epsteinjerome corsijfk assassination
00:32:25
16 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Iran-Israel War Intensifies. Is There an End in Sight?
#zelenskyvance boltonukraine conflictactblueatomic iranayatollah khomeinidemocratic partyeconomic crisisimmigration policyisrael iran warjerome corsimelissa hortmannational debtswiss americatransgenderism
00:34:47
13 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
Secret Rituals: The Darkness Underneath the Silcom Valley Elite, Part 4
#silicon valley conspiracysilicon satansatanic rituals9 11 conspiracyanti globalist manifestobill clintonconspiracy theoriescraig lundhasatanhsbc money launderingjeffrey epsteinjerome corsijfk assassinationluciferian elitenew world orderp diddyreligious conflict
00:55:40
12 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
The Money and Power Behind the Riots: This is No Grass-Roots Movement
#transhumanismtd bankpolitical insurrectionabc newsacluact bluealexandria ocasio cortezantifacnndr dronejerome corsilos angeles riotsmaxine watersmedia censorshipnew world orderngo funding
00:20:41
10 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
The LA Riots: Insurrection Theater and the Left’s Downward Spiral
#social unrestpolitical insurrectionpatriot act2026 electionabc newsactbluealexandria ocasio cortezauthoritarianismcultural identitydemocratic partydonald trumpjerome corsilos angeles riotsmaxine watersmedia censorshipms 13
00:30:45
05 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
Spiraling toward world war III: The Economic Factor
#xrpworld war iiivolodymyr zelenskyallianz tradecrimea bridgecryptocurrencydonald trumpeconomic collapseexecutive powerfederal reservegold standardiran nuclear programjerome corsiparis riotssocial securityswift systemukraine warvladimir putinvolkswagen
00:36:20
04 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
Debt, Trade Battles and the Future of the U.S. Economy
#us economyukraineswiss americabasel iiicopiapó portcrimean bridgedonald trumpfederal reserveglobal conflictgold investmentimmigration policyjerome corsijerome powellmodern monetary theorymonetary reformmyvitalcscott bessent
00:26:03
03 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Are We Closer to a Russia-Ukraine Ceasefire or WWIII?
#world war iiisteele dossierrussia ukraine warcorsi nationcrimeagates institutegeneral flynnglobal economic crisisgreat replacement theoryjerome corsijulian assangekerch bridgemueller investigationnatonato expansionpresident zelensky
00:38:10
29 May
Thu
The Truth Centra...
Dr. Jerome Corsi
The Debt Crisis: Credit Default Swaps are Happening Again
#td banksinaloa cartelproject veritasburismacredit default swapscultural maoismcultural marxismdavid hoggdepartment of government efficiencyeconomic collapseelon muskgeopolitical conflicthunter bidenimmigration policyjerome corsikash patelnational debtneo marxismpolitical corruptionprecious metals
00:40:55
28 May
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump vs. Harvard Heats Up
#zelenskyukraine wartrump administrationdan bonginofederal funding cutsglobal economic collapseharvard universityhillary clintonisrael hamas warjerome corsimedia biasprovokeputinscott hortonswiss americatodd callender
00:35:00
27 May
Tue
The Truth Centra...
Dr. Jerome Corsi
DOJ Cracks Down on Child S*x Exploitation
#zelenskyxrpukraine warbelt and road initiativechild sex traffickingcolorado state legislaturecraig lunddemocratic party conspiracyeconomic declinefrankfurt schoolhamasisrael hamas warjerome corsikash patelmichael rosenetanyahuoperation restored justicepam bondiswift system
00:41:25
22 May
Thu
The Truth Centra...
Dr. Jerome Corsi
The #JFK Assassination Coverup #Evidence on the Car’s Windshield, a Deep Dive
#x raysvietnam warthe final analysis9 11bethesda doctorsciaconspiracy theoriesdavid osbornedeep stateford motor companygeorge whitaker srhistorical revisionismhr freemanivalia glangesjerome corsijfk assassinationjohn f kennedylee harvey oswaldlone gunman theorymilitary industrial complexnational archivesrobert harrisonstavis ellistexas school book depository
00:45:51
20 May
Tue
The Truth Centra...
Dr. Jerome Corsi
The DOJ Takes on California’s ‘Sanctuary State’ Policy
#voter fraudus attorney essaleysupreme court justice robertsalexandria ocasio cortezbarack obamaconspiracy theoriescraig lundeconomic crisisgeorge sorosimmigration enforcementjames comeyjerome corsijoe bidenjudicial reformmark eliasmike mccormickperkins coiesanctuary citiessatanism
00:42:29
15 May
Thu
The Truth Centra...
Dr. Jerome Corsi
Ukrainian-American Wrongfully Persecuted by the Biden DHS: Dmitry Kudryn Tells His Story
#zelenskywitch huntweaponized justicecriminal prosecutiondepartment of homeland securitydimitri kudrindonald trumpgods5stonescomimmigration enforcementjerome corsimike novaneo marxistpolitical corruptionrussia ukraine conflictty bishopvladimir putin
00:49:21
14 May
Wed
The Truth Centra...
Dr. Jerome Corsi
The Luciferians’ Obsession with Hawaiian Culture
#transhumanismsilicon satansatanic cultsadrenochromeancient hawaiian culturecocainecraig lunddrug useecstasyjeffrey epsteinjerome corsikalua pig ritualking kamehamehap diddypedophilia
00:52:04
13 May
Tue
The Truth Centra...
Dr. Jerome Corsi
The New Pope and the Direction of the Catholic Church with Mike McCormick
#vatican politicsvatican banksinaloa cartelarchbishop carlo maria viganòcardinal theodore mccarrickcatholic churchchinese communist partydeep state conspiracydennis mcdonoughglobalismimmigration policyjerome corsijoe bidenjuan orlando hernandezmike mccormickpope francispope leo xiv
00:53:31
12 May
Mon
The Truth Centra...
Dr. Jerome Corsi
Was Jeffrey Epstein An Intelligence Asset? Why Did Powerful Democrats Meet With and Enable Him?
#william burnsvoter fraud allegationsvladimir zelenskybasel iiibricscatherine rumerdonald trumpeconomic collapsegold standardjeffrey epsteinjeffrey epstein conspiracyjerome corsilou provostnancy pelosiphilip escaravagepope francisukraine russia warus china trade deal
00:43:49
09 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Who is Pope Leo XIV? Plus: Two Big Wars Poised to Escalate
#zelenskyukraine conflicttom tillisbelt and road initiativecasey meanscatholic churcheconomic collapseed martingazahamasisrael hamas warjanuary 6th insurrectionjeanine pirrojerome corsijoe bidenmacronneo marxismpope leo xivrobert f kennedy jrrobert francis prevost
00:37:35
08 May
Thu
The Truth Centra...
Dr. Jerome Corsi
Turncoat Tillis Blocks Ed Martin’s Nomination; Kash Patel Schools Leftist Pol on Accountability
#veterans firsttom tillisprince andrewconspiracy theoriesdavid horowitzdemocratic partyeconomic collapseed martinhenry kissingerhomeless veteranshunter bidenjanuary 6th insurrectionjason goodmanjeffrey epsteinjerome corsikash patelmedia censorshipmichelle obama
00:41:26
06 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Trump Wants Gold Star Mom and Political Prisoner Released from a Colorado Prison
#zelenskyuniversity of washingtonuniversity indoctrinationalina habbaantifaconspiracy theoriesdan bonginodonald trumpelection fraudgeorge sorosharvard universityisrael hamas warjerome corsijoe bidenkash patellawfarenatonord stream pipelinetina petersukraine conflict
00:35:13
05 May
Mon
The Truth Centra...
Dr. Jerome Corsi
New Evidence of Voter Roll Integrity Issues in Wisconsin: Plus, Trump’s ‘Meet the Press’ Convo
#voter fraud allegationsvolodymyr zelenskytulsi gabbardarchbishop viganocatholic church politicsdonald trumpeconomic collapsegold pricesisrael gaza conflictjerome corsijoe bidenkamala harriskash patelkristen welkermartin armstrongmeet the pressms 13nuclear war theorypope francispresidential interviews
00:46:55
30 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Finally: A Task Force on Election Integrity Will Be Assembled
#ukrainetrade policyreligious controversyadam schiffalina habbaandrew paquetteanthony moranarchbishop viganoconspiracy theoriesdisease xed martinelection integrityfinancial marketsforeign interferencejerome corsikash patelkristi noemms 13mueller investigationpope francis
00:43:23
29 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Blood Rituals and the Destruction of the Nuclear Family with Cregg Lund
#sloansilicon valleysilicon satanadrenochromeadrenochrome extractionanniecraig lundgene hackmanhollywood infiltrationjerome corsiluciferian cultsluciferiansnuclear familyrajred scarfsatanists
00:46:53
25 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
The Hidden Evil Surrounding the Dark Alliance Between the Deep State and Deep Church
#wuhan pandemic originstheodore mccarrickpope francisalliance for prosperityan almost insurmountable evilcatholic church corruptiondeep statedeep state conspiracydennis mcdonoughimmigration policyjerome corsijohn f kellyjorge bergogliojuan orlando hernandezlgbt agendamike mccormickmorality laundering
00:51:52
24 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Tulsi Gabbard Refers Two Who Leaked Classified Info to WaPo, NYT for Prosecution
#vladimir zelenskytulsi gabbardtrump administrationburismadojo leadershipforeign policyhillary clintonjerome corsijoe podestajohn robertsjudicial reformkash patelmatt drudgems 13pam bondipope francisreligious freedomsocial security
00:32:42
23 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Again: Where Are the Investigations as Lawfare Against Trump Elevates?
#world economic forumtesla showroomssoros judgesarticle ii powerschief justice robertsconspiracy theoriesdoge initiativeelection integrityelon muskfederal government reformglobal economic crisisjerome corsijudge boesburgjudicial independencekash patelklaus schwabobamacarepam bondiron johnson
00:42:01
18 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Dem Senator Sips Cocktails with Gang-Affiliated Deported Illegal Immigrant
#religious fundamentalismpolitical corruptionpaul g sawyersaileen boasbergbarack obamachris van hollenclaudine gayconspiracy theoriesdonald trumpeconomic collapseeuropean uniongilmar obrego garciaharvard universityimmigration crisisjerome corsijerome powelljoe bidenluigi mangione
00:41:42
17 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Seduction and Grooming: The Darkness Under Silicon Valley’s Cloak - Part 5
#wheres wallysilicon valleysilicon satanadrenochromearchbishop mccarrickbiden administrationchild safetyconspiracy theoriescorsi nationcraig lundherbert marcusejerome corsijfk assassinationmike mccormickpost hill presssatanic panicsexual revolution
00:48:24
16 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump’s Election Integrity Investigation is Ongoing: What Happens Next
#tulsi gabbardtina peterssalt typhoonarticle iichristine noemchristopher krebsdonald trumpelection integrityexecutive powerfinancial crisisforeign interferencejerome corsijohn radcliffeletitia jamesmichael flynnnational securitypam bondi
00:44:57
15 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Unraveling the Media Narrative on Trump’s Deportations
#xrpusaidtucker carlsonbelt road initiativebozabardonald trumpeconomic policyfederal reserveforeign policyharvard universityjerome corsimarco rubiomarxism critiquemedia criticismpete moroccostephen millertrump administration
00:40:53
11 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Gabbard: Electronic Voting Systems Vulnerable to Hackers and Manipulation
#xrpvoting system fraudviktor pinchukbabylon beechris krebsdemocratic party criticismdominion voting systemsdonald trumpelection integrityihor kolomoiskyjerome corsioperation election integritypam bondipolitical conspiracy theoriestrump foreign policytulsi gabbard
00:48:09
10 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Why is Pam Bondi Still Dragging Her Feet On Corruption Investigations?
#zelenskyvoter fraud allegationstulsi gabbardadam schiffattorney general bondicritical race theorydemocratic party corruptiondisease xeconomic collapseed martinelizabeth warrenforeign policy critiquejames clapperjerome corsijohn brennanpam bondiswiss america
00:39:28
08 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Supreme Court Backs Trump on Deportations, but with a Catch...
#voter fraudvladimir zelenskyukraine waralien enemies actconspiracy theorieseconomic collapsefederal reserveforeign policygeorge sorosjerome corsijohn robertsjudicial tyrannyjulian assangemueller investigationsusan crawfordswiss americatren de agua
00:42:32
07 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Trump’s Tariff Plan is Coming Together While the Left Acts Out
#zelenskyukraine warswiss americaclinton foundationconspiracy theoriesdonald trumpeconomic policyforeign interventiongeorge sorosglobalismjerome corsijoe bidenklaus schwabmaidan rebellionmueller investigationpolitical corruptionsusan crawford
00:39:37
02 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Inside Hollywood’s Whitewashing of the Catholic Church Coup Against Pope Benedict
#wuhan pandemicthe two popestheodore mccarrickalliance for prosperityan almost insurmountable evilcatholic churchciaconspiracy theoriesglobalismhigher ground productionsjerome corsijorge bergogliojuan orlando hernandezmedia censorshipmike mccormickobama biden administrationpolitical influencepope benedict xvipope francis
01:03:39
01 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#sidney powellscott wiperrussian ambassadordeep statedefense intelligence agencydocumentary filmmakingfbifixing intelflynn the moviegeneral michael flynnjerome corsilori flynnmichael flynnmueller investigationobama administrationplea bargaining
00:52:23
25 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvalerie jarretttrump impeachmentassassination of jfkbruce ohrcarlo maria viganòchristopher steeleconspiracy theoriescoup détatdeep statedonald trumpjerome corsijohn f kennedyjohn mccainmichael isikoffnew world orderseth richthe final analysis
00:44:16
21 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive
#vietnam wartriple underpassthomas mills9 11ciaconspiracy theoriesdavid osbornedeep statedr malcolm perryevalia glangesforensic evidencegeorge whitaker sriraq warjerome corsijfk assassinationjohn f kennedynational archivesrobert harrisonstavis ellisthe assassination of john f kennedy the final analysis
00:43:45
20 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
The Left Knowingly Lied All Along: It's Time to Investigate Them
#wisconsin state board of electionvoter registrationsusan crawfordbarack obama birth certificateconspiracy theoriescovid 19 origincultural criticismdisney snow white remakeelection fraudgeorge soroshunter biden laptopjerome corsijfk assassinationpeter dinklagepolitical corruptionrachel zieglersteele dossier
00:48:19
19 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
Who Is Radical Judge James Bosaberg, Who Tried to Stop Illegal Immigrant Gang Deportation Flights?
#voter registrationvladimir putinukraine warbianca lynn breezebill barrelection frauderic hovdefisa courtgods five stonesjames boasbergjerome corsijfk assassinationjohn robertslee harvey oswaldmary mccordpeter titkinsupreme courtsusan cantorsusan crawford
00:41:21
18 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
Democrats in a Tizzy over Venezuelan Gang Deportations, Biden’s Autopen Consequences
#zelenskyvoter roll integrityukraine warandrew weissmanconspiracy theoriescoup detatdonald trumpelection fraudgods five stoneshamashelp america vote actimmigration policyinternational conflictjerome corsijoe bidenmueller investigationpam bondi
00:27:33
17 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
Ukrainian-American Wrongfully Persecuted by the DHS: Dmitry Kudryn Tells His Story
#voter registration integrityukrainian heritagespecial agent tide bishopcouchgate casedepartment of homeland securitydhs prosecutiondimitri kudrindonald trumpelon muskjerome corsimike novapeter ticktonpolitical pardonspresident zelenskyrussian ukrainian conflictsoviet kgb
00:49:21
14 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
Coming Documentary to Expose Info on UFOs/UAPS
#zelenskyusaid fundinguap disclosureactblueamaryllis fox kennedyanti vaccine movementcloward piven strategycolumbia universityconspiracy theoriescorsi nationdepartment of justiceeconomic collapsejames comerjerome corsijohns hopkinsmrna vaccinespolitical corruptionsilicon satan
00:46:10
13 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
Secret Rituals: The Darkness Underneath the Silcom Valley Elite, Part 4
#world trade centersilicon valley cultsilicon satanbook of revelationbuilding 7ciaconspiracy theoriescraig lunddeuteronomyjeffrey epsteinjerome corsikennedy assassinationluciferian cultmetaversep diddypolitical corruptionreligious conflictsatanic rituals
00:55:40
12 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
What’s Going on, Pam Bondi? Where Are the Investigations?
#usaid document destructiontesla attacksreligious politicsarchbishop viganoattorney general investigationsconspiracy theoriesdeep state corruptioneconomic crisisepstein evidenceerica carrfederal reservej6 committeejack posobiecjerome corsikash patelmatt gaetznational debtpam bondipope francis
00:46:25
10 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
Russia’s Kursk Offensive; Dem Fundraising Arm in Big Trouble
#zelenskyvoter registration listsus military aidabraham accordsalgorithmic gerrymanderingbuilding 7conspiracy theoriescryptocurrencyelection integritygods5stonescomgovernment bureaucracyisrael palestine conflictjerome corsijfk assassinationjulian assangekursk offensivemaidan rebellionmueller investigationsyria massacrestrump re electionukraine war
00:34:02
07 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
The Hidden Darkness Behind the Silicon Valley Elite 2: with Silicon Satan author Cregg Lund
#silicon valley elitesilicon satansatanic ritualsandrew tatebarack obamaconspiracy theoriescraig lunddonald trumpepstein filesjerome corsilarry ellisonlucifer warsnorman vincent pealeoprah winfreyp diddyred scarfingreligious conflictrobin williams
01:07:26
06 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
EU Tough-Talk Bringing World Closer to World War III; Trump's Final Ultimatum to Hamas
#zelenskyvladimir putinunconspiracy theoriesdeath valleyelection fraudemmanuel macronforeign policyhamasisrael hamas warjerome corsijohn podestamail in ballot fraudmueller investigationnatoroe v wade
00:30:56
05 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump Addresses State of the Union; BlackRock Buys Several Panama Ports
#xrpreligious nationalismpolitical polarizational greenamtrakblackrockdonald trumpeconomic policyhillary clintonhutchinson ports groupimmigration reformisisjerome corsijohn kerryjohn mccainpanama ports company
00:31:27
03 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
Zelenskyy's White House Hissy-Fit Aftermath and the EU's Flimsy Tough Talk
#xrpvoter fraudvolodymyr zelenskyychuck schumercollateralized debt obligationscorsinationcrypto regulationglobal financial crisisjake sullivanjerome corsinato obsolescencepeter ticktonrocky rockfordtrump gazaukraine conflictvictoria nuland
00:50:01
28 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
The Truth About the CCP's Bioweapons Research and Measures Taken to Hide it with Dr Li-Meng Yan
#xi jinpingwuhan international airportuniversity of hong kongbioweapon theorychina disinformationchinese communist partycovid 19 originsdr li meng yangain of functiongain of function researchjerome corsimilitary civil fusionpeoples liberation armypeter daszakralph baricreceptor binding domainshi zhengli
01:01:55
26 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
Putting Patients in Charge of Their Health Care w Dr. David Hartsuch: Part 2 - Hyperbaric Treatments
#vaccine skepticismrobert kennedy jrpharmaceutical industryanthony faucibh2bh4big farmconspiracy theoriesdavid hartsuchdeep statedonald trumphealthcare reformhyperbaric oxygen therapyjerome corsijfk assassinationlee harvey oswaldnew world order
01:05:20
25 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Corsi Talks with Susan Olsen: Cancelled from a Brady Bunch Revival, Growing up in Hollywood, Thoughts on Today's Issues
#susan olsenrobert f kennedy jrreligious freedombrady bunchchild actorscovid 19deidonald trumphydroxychloroquineivermectinjerome corsijudeo christian valuesmanson familymedia censorshipmmr vaccinepolitical polarizationpublic health policy
00:57:00
21 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
Kash Patel Confirmed as Deep State Rats Freak Out
#silicon satanroger stonereligious scandal2008 subprime crisisadam schiffcatholic church scandalcriminal justice reformdeep state conspiracyeconomic collapseimmigration policyjerome corsijulian assangekamala harriskash patelkathy hochulmises institutemueller investigationpodesta emailspope francis
00:41:03
20 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
Trump Calls Out ‘Dictator’ Zelenskyy; Pope Francis’ Declining Health: What Happens Next?
#volodymyr zelenskyyvaddy leakssilicon satancarlo maria viganòcatholic churchcraig lundelection integritygods five stonesgovernment overreachimmigration policyjerome corsikathy castorkathy hochulpeter ticktonpope francisreligious freedomroe v waderussia ukraine war
00:43:47
19 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
Dems Still Tizzied over Government Overhaul, Zelenskyy Should Face Election as Part of Peace Plan
#volodymyr zelenskyvatican conspiracyukraine warcarlo viganodepartment of government efficiencyelection integrityelon muskgovernment efficiencyjerome corsikathy castormarco rubiopeter ticktonpope francisrocky rockfordsergei lavrovstephen miller
00:42:53
18 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
The Hidden Evil Surrounding the Dark Alliance Between the Deep State and Deep Church
#wuhan pandemictheodore mccarrickpope francisalliance for prosperitycatholic churchdeep stateforeign policygeneral john f kellygeneral mark milleyimmigration crisisjerome corsijohn podestajuan orlando hernandezkash patelmike mccormickoperation condorpam bondipandemic origins
00:52:02
14 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
The Darkness Hidden Under Silicon Valley's Cloak with Corinne Lund - Part 2
#smith mundt actsilicon valleysilicon satanbaby roastingbarack obamaconspiracy theoriescorinne lundcraig lundhuman sacrificejeffrey epsteinjerome corsilarry ellisonluciferian elitemark zuckerbergpolitical corruptionreligious extremismsatanic conspiracy
00:49:54
13 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
DOGE Keeps Winning, Deep State Rats' Defense Crumbling
#ukraine russia warthe truth centralrobert f kennedy jrdogedonald trumpelection integrityelon muskfederal bureaucracyimmigration policyjerome corsikathy hochulmanufacturing declinemaxine watersmedicaidmedicarenancy pelosipam bondipeter titkin
00:37:35
12 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
DOGE Continues to Steamroll Bureaucracy, Expose USAID Abuses
#xrp ledger technologyvolodymyr zelenskyusaid reformdepartment of justicedonald trumpelection integrityfinancial regulationgods five stoneshamasjerome corsijudicial independencelindsey grahammark fogelmiddle east conflictnancy pelosiroe v wadesamantha powersthetruthcentralcomukraine peace effortsusaid
00:37:25
11 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Trump's Hamas Ultimatum; A Dem Advisor Says Biden's Presidency was Obama's 'Third Term'
#usaidukraine warrocky rockfordcarlo maria viganòdeep statedeep state conspiracydonald trumpelection integrityelon muskgaza purchasegreen new dealjerome corsijim acostamedia censorshipmiddle east policypeter ticktonpope francisreligious freedom
00:37:01
10 Feb
Mon
The Truth Centra...
Dr. Jerome Corsi
Will Trump's Plans for Gaza Work? Corrupt Voter Roll Algorithms Found in Florida?
#voter fraud allegationsvenezuelausaidcarlo maria viganodeep state conspiracydonald trumpeconomic recessionelon muskgazagreen new dealhamasisrael hamas warjerome corsijim acostapeter ticktonreligious freedomrocky rockford
00:36:35
07 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
The Left’s DOGE Meltdowns Continue as Corruption and Abuse Continue to be Exposed
#usaidreligious freedompope francis2024 electionandrew paquetteantifabiden administrationblack lives mattercarlo maria viganòchuck schumerdeep statedemocratic partyelection fraudelon muskhakeem jeffriesjerome corsineo marxismpeter tiktin
00:35:31
06 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
DOGE Reveals More Egregious USAID Abuses as Democrats Continue to Melt Down
#usaidreligious freedompope benedictarchbishop viganociaconspiracy theoriesdogedonald trumpelection integrityforeign aid corruptiongovernment surveillancegreen new dealisisjerome corsijfk assassinationjohn thomas leelee harvey oswaldpeter titkin
00:46:52
05 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump’s Plans for Gaza, Iran, Downsizing the CIA
#un refugee agencytulsi gabbardreligious politics2020 electionabraham accordsarchbishop higanobob fettermanciacia reformdeep statedonald trumpelection integritygazagods five stonesgovernment downsizingiran sanctionsisrael hamas warjerome corsikash patelpam bondi
00:31:48
04 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Did the Deep State and the Deep Church Accommodate Drug and Child Trafficking Out of Honduras?
#vatican conspiracytom donilonpope francisalliance for prosperitycardinal mccarrickchild sex traffickingdennis mcdonoughdrug traffickingel chapohondurasimmigration policyimpeachmentjerome corsijoe bidenjuan orlando hernandezmike mccormickobama biden administration
00:47:45
03 Feb
Mon
The Truth Centra...
Dr. Jerome Corsi
Trump, Musk Target USAID Abuses; Zelenskyy Says He Only Receved $75B of $177B Aid
#vatican conspiracyusaid reformusaidanti globalist alliancecarlo maria viganòdeep statedepartment of government efficiencyeconomic collapseelon muskgeorge sorosglobalist agendagovernment efficiencyjerome corsimark finchemoffice of personnel managementpope francis
00:38:12
31 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
The Washington Helicopter-Plane Crash: Beyond the Headlines
#swiss americarobert f kennedy jrrichard blumenthalaviation safetybernie sandersbiden administrationconspiracy theoriescritical race theorydeidepartment of transportationeconomic collapseelection fraudelizabeth warrenfaagods5stonesjerome corsikash patelpete buttigiegpolitical corruption
00:45:05
30 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
The Truth About What Happened and What's Happening with the January 6th Protesters: J6ers Speak Pt. 2
#washington gulagvets for trumptrump pardonsashley babbittbank of americabenjamin phillipbrian sicknickcivil rightsdeep stategeorge sorosjanuary 6thjerome corsijoshua maciaskevin greesonlegal obstacleslindsey grahammatthew huddleroseanne boylan
00:54:07
29 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
The Truth About What Happened to the January 6th Protesters: J6ers Speak Pt. 1
#veterans for trumptucker carlsonselective prosecutioncapitol policeconstitutional rightsdeaderek stormsdojfederal overreachjanuary 6thjerome corsijoshua maciasjudicial systemmark ibrahimmarxist stylepresidential pardon
00:54:52
28 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
he US’ Big Media Oligarchy RFK Jr, Gabbard to Face Confirmation Hearings
#teresa milo young bluntswiss americapolitical corruptioncorsi nationcraig lundcultural marxismeconomic collapseelaine chaoelection integrityfelix ophelia bucholdimmigration policyjack smithjd vancejerome corsijim acostaklaus schwabmedia censorshipmerrick garlandmitch mcconnellnew world order
00:38:23
27 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Plagiarism in Academia: the Decline of Academic Integrity and Leadership with Dr. Carol Swain
#trump executive orderthe gay affairplagiarismacademic integrityart lafferblack faces black interestscancel culturecarol swainclaudine gaydei programsharvard universityidentity politicsjerome corsikamala harrismartin luther king jrmeritocracynational science foundation
00:46:47
24 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
Deep State Judges Purposely Slow-Rolling Release of Pardoned J6 Protesters
#silicon valley criticismsilicon satanrfk assassinationconspiracy theoriescraig lunddonald trumpdonald trump presidencyeli cranejanuary 6 insurrectionjeffrey epsteinjerome corsijfk assassinationjudge kellyjudge nicholsmlk assassinationp diddyreligious fundamentalism
00:34:19
23 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
The Darkness Under the Cloak of Silicon Valley with Corrine Lund
#vaccine advocacytrumpsilicon valleyadrenochromealliance defending freedombaby harvestingconspiracy theoriescorrine lundcraig lunddepopulationdiablo nuclear power plantjeffrey epsteinjerome corsip diddyreligious freedomsatanic ritualssilicon satan
00:48:38
22 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
The Trump Administration is Off and Running: DEI is Dead, J6 Protesters Pardoned and More
#transgender rightsoperation warp speedmrna vaccinesanthony faucibiden administrationbill gatesdei cancellationdonald trumpeconomic collapseglobalist conspiracygold rushjanuary 6th insurrectionjerome corsikash patellauren boebertlgbtq+ criticismliz cheneymark zuckerberg
00:29:19
21 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda
#victoria nulandvatican iithe truth centralbruce ohrcarlo maria viganòchristopher steeleciaconspiracy theoriesdeep statedonald trumpdoug hornfusion gpsjerome corsijfk assassinationjohn f kennedynew world orderrobert muellerrobert mueller investigationseth rich
00:45:58
20 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Al Gore's Climate Alarmism Rejected by His 'Mentor;' New Documentary from Joel Gilbert
#world economic forumwind energythe climate according to aiai technologyal gorecarbon dioxideclimate changejerome corsijoel gilbertour plundered planetreligious zealotryroger revellescientific fraudsherwood idsosolar energy
00:36:17
14 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
California Fires Reveal Incompetence of Woke Officials; The WEF’s True Carbon Tax Motives Exposed
#zelenskyworld economic forumukraine waragenda 2030barack obamablackrockchristy crowleyclimate changeconspiracy theoriesdemocratic partydonald trumpelection integrityeric hovdegavin newsomisisjerome corsijfk assassinationjoe bidenkamala harris
00:40:27
13 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Leftists Move Hard on Global Destabilization Before Trump Takes Presidency
#united nations 2030 agendatrump presidencyswiss america15 minute citiescalifornia firesciacorsi nationdeep statedei initiativeseconomic collapseelection integritygavin newsomglobalist agendagods five stoneshegelian dialecticsjanuary 6thjerome corsimaui disaster
00:41:29
10 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
The Deep State’s Evil Intentions Behind the CONCLAVE Movie with Mike McCormick
#world economic forumtheodore mccarrickpope francisarchbishop viganocatholic churchciaconclaveconspiracy theoriesdeep stateglobalismimpeachmentjaccusejerome corsijoe bidenjorge bergogliomike mccormickobama deep state
01:10:11
08 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
More Evidence Comes Out About the Obama CIA’s, FBI’s Russian Collusion Hoax and Coverup
#veterans affairsthetruthcentralreligious fundamentalismarchbishop viganoconspiracy theoriescoup detatdonald trumpelection integrityfive eyesgovernment surveillancejerome corsijohn brennanjustin trudeaumar a lagomatt taibbimichael schellenbergerpalisades firepolitical extremism
00:43:40
06 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Why the Heck Did Biden Give George Soros and Hillary Clinton the Congressional Medal of Freedom?
#ukrainethetruthcentralmueller investigationbricscongressional medal of freedomdemocratic partydonald trumpelection integrityfive eyesgeorge sorosglobal economic collapsehillary clintonjanuary 6 insurrectionjerome corsijoe bidenjuan merchan
00:45:20
03 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
The Biden Administration Considered Attacking Iran
#wisconsintrump administrationthe truth central9 11 attacksarizonabarack obama birth certificatebiden administrationbuilding 7conspiracy theoriescritical race theoryeconomic collapseelection irregularitiesforeign policyiran nuclear facilitiesjerome corsikash patellee harvey oswaldmichigannevadapennsylvania
00:45:24
02 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
The New Year’s Terrorist Attacks: What We Should Be Asking About Them
#trump international hoteltesla cybertruckterrorist attacksconspiracy theoriesdemocratic partydow jones industrial averageeconomic collapsefbifederal reserveisisjerome corsijfk assassinationlas vegasnew orleansobamapolitical extremismreligious freedomshamsuddin jabbar
00:46:54
31 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
An Honest Look at Jimmy Carter’s Presidency; How Our Civilization is Destroying Itself
#the truth centralpresidential criticismpanama canalcivilization suicidecultural decaydeep statedeep state conspiracydonald trumpeconomic collapseelection fraudgods five stonesiranian hostage crisisjerome corsijimmy carterjoe bidenmichael snyder
00:42:46
30 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Exposing Corruption of the Deep State and Biden Admin as Trump Prepares for Presidency
#yuval noah harariworld war iiiwoke agendabiden administrationcultural marxismdeep statedemocratic partydepartment of justicediversity equity and inclusiondonald trumpelection fraudjerome corsinational debtrobert muellerukraine conflictvladimir putinvoter fraud
00:37:29
23 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
The #JFK Assassination Coverup: #Evidence on the Car’s Windshield, a Deep Dive
#warren commissionthe final analysisstavis ellisalton photographsciaconspiracy theoriesdeep statedr manticford motor companygeorge whitakergovernment cover upjerome corsijfk assassinationjohn f kennedylee harvey oswaldmalcolm perrynational archivesrobert harrisonsecret service
00:45:13
20 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
No, It's Not Okay for the Government to Constantly Lie to Us, What Today's Leaders Can Learn from History
#washington postwall street journaltransgender rightsbiden administrationbill gateschristopher wrayclimate change denialdonald trumpeconomic collapseelection interferenceigor shafarevichjerome corsijohn robertsjonathan cahnjulian assangemerrick garlandmeta instagramnew york timessocial media censorship
00:42:47
19 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Defending Religious Freedom in the U.S. with Chaplain Gordon (Dr. Chaps) Klingenschmitt
#usa fencingtransgender issuessecnav instruction 17307cabortion rightschristian persecutioncountry of particular concerndonald c winteremtalaeva edelgordon klingenschmittgovernment overreachjerome corsilawfaremilitary chaplainspray in jesus name ministriesreligious freedomron wagner
00:52:31
11 Dec
Wed
The Truth Centra...
Dr. Jerome Corsi
Howard Zinn’s False History and its Damage to the Quality of American Education
#thomas jeffersonthe truth about neo marxismsaul alinskyanarchybarack obamacritical race theorycultural maoismeconomic collapsefrankfurt schoolgettysburg addressglobalismherbert marcusehoward zinnisrael hamas conflictjerome corsimichelle obamaneo marxismpeoples history of the united states
00:43:04
09 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Will Joe Biden Pre-Emptively Pardon the J6 Committee? Syria’s Assad Regime Falls
#tulsi gabbardthe final analysispope francisadam schiffanthony faucibiden self pardoncoast to coast amdeep state conspiracyelection fraud claimsgeneral milleygods 5 stonesjanuary 6th committeejerome corsijfk assassinationliz cheneyoperation crossfire hurricanepolitical corruption
00:31:44
06 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Analysis: Tucker Talks with Russia’s Lavrov; David Hogg Wants to Run the Democrat Party
#tucker carlsonswiss americasergei lavrovazov brigadesbill gatesdavid hoggdeep state conspiracydemocratic national committeedemocratic party critiqueeconomic collapsegun rights debatejerome corsiklaus schwaboreshnik missilerussia ukraine war
00:56:37
05 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions
#social justicescientific skepticismrachel carsonbrian sussmancarbon neutral gridclimate changeclimate cultclimategateecotyrannyenvironmental policyfriedrich engelsgeoengineeringgreen new dealjerome corsimarxismmilgram experimentpaul ehrlich
01:01:45
04 Dec
Wed
The Truth Centra...
Dr. Jerome Corsi
The Democrats' Devious Smear Campaign Against Pete Hegseth
#volodymyr zelenskytucker carlsontony blinken14th amendmentbiden administrationbricsburismaconspiracy theoriescraig lunddonald trumpeconomic collapseelection fraudforeign policygods five stoneshunter bidenjerome corsipolitical corruption
00:38:50
29 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Walter Duranty: Stalin’s PR Agent for the New York Times
#world economic forumwalter durantyukrainian faminealeister crowleycarlo viganocultural maoismgareth jonesglobalist conspiracyjerome corsijoseph stalinmalcolm muggeridgeneo marxismnew york timesnkvdpope leo xiiisj taylorstalin regime
00:39:14
27 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Why NATO’s Tough Talk of a Pre-Emptive Attack on Russia Will Backfire
#yuval noah hararivoter fraudukraine warandrew paquettearchbishop viganobiden administrationcalifornia district 28economic preparednesselection integrityforeign policygods five stonesjerome corsikamala harrismichael waltznatonato strategyrussiasebastian gorkaswiss america
00:43:15
26 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
he Truth About the CCP's Bioweapons Research and Measures Taken to Hide it with Dr Li-Meng Yan
#zxc21zc45xi jinpingbioweapon theorychina policychinese communist partycovid 19 origindr li meng yangain of function researchjerome corsipeoples liberation armypeter daszakralph baricshi zhengliuniversity of hong kongwho integritywuhan international airport
01:00:54
22 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
More States To Investigate Election Integrity; Ukraine-Russia Conflict Inching Closer to World War
#zelenskyvladimir putinukraine russia warandrew paquetteconspiracy theoriescrimeademocratic partydonald trumpelection integrityeric havdijerome corsijohn f kennedy assassinationkamala harrisnatotammy baldwinthe final analysis
00:39:35
21 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#turkeysidney powellscott wiperbarack obamadeep state conspiracydonald trumpfbi entrapmentflynn the moviegeneral michael flynnisisjerome corsijim clapperjohn brennanmedia censorshipmike pencemueller investigationrance priebus
00:53:16
20 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump Continues to Assemble His Team as Corrupt Dems Go into Sabotage Mode
#ukraine warswiss americareligious valuescarlo maria viganodeep stateelection fraudfinancial crisisgods five stoneshunter biden laptopjames comeyjerome corsijohn kellymarco rubiomark espermatt gaetzmodern monetary theorynoah hararioperation crossfire hurricane
00:34:32
19 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Ukraine Launches ATACMS Missiles on Russia, Putin Lowers Nuclear Strike Threshold
#voter fraudvladimir putinukraine war2026 electionsatacms missilesbiden administrationcritical theorydeep statedonald trumperic hovdejerome corsimatt gaetzneo marxismnuclear conflictpennsylvania supreme courtsilicon satanswiss americathetruthcentral
00:34:40
18 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Is Biden Trying to Start World War 3 as He Tries to Seal His Legacy?
#the truth centraltammy baldwinsilicon satanarchbishop viganobig pharmaconspiracy theoriescraig lunddonald trumpeconomic collapseelection frauderic hovdeforeign policyhillary clintonjerome corsijoe bidenkamala harrisoperation crossfire hurricanereligious extremism
00:34:54
15 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
The Democrats Reveal their True Selves Through Post-Election Day Weasel Tactics
#wisconsin electionsvoter fraud allegationsreligious conservatismbob caseyciaclone votersdeep statedeep state conspiracydepartment of justicedonald trumpeconomic inflationelection integrityfbigjensidiegold and silverjerome corsipennsylvania elections
00:37:14
14 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Are the Democrats Trying to Steal the PA Senate Race? The Left’s Plans to Undermine Trump are Underway
#the truth centralswiss americaperkins coiearchbishop viganocivil unrestcryptocurrency regulationdave mccormickdonald trumpelection fraudforeign policygods five stonesjerome corsilawfaremark eliasmelania trump
00:42:34
12 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
The Biden, Obama Administrations’ Corruption and Collaboration with the Deep Church
#vatican politicstheodore mccarrickpope francis2020 election fraudalliance for prosperityan almost insurmountable evilarchbishop viganobergogliocardinal parolincatholic church corruptiondeep state conspiracydennis mcdonoughjerome corsijoe bidenlgbtq rights controversymike mccormicknoah harariplandemic
01:08:24
11 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
The Effects of Exposing Corrupt Voter Roll Database Algorithms on the 2024 Elections
#ukraine warreligious freedompope francisalexander zelenkoarchbishop carlo maria viganòclimate change denialdeep state conspiracydei regulationsdonald trumpelection fraudesg regulationsglobal economic collapsegods five stoneshydroxychloroquinejensidiejerome corsijorge murillo bergogliokamala harris
00:38:44
08 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Continuing Research on Suspicious Algorithms in Some States' Voter Roll Databases Post-Election Day
#wisconsinvoter registrationthe georgia nerdsabsentee ballotsarizonaciadata integrityelection fraudforeign interferencegeorgiagods5stonescomjensidie insurancejerome corsikopriks grocery storengo activitypennsylvaniasouth carolina
00:17:29
07 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Watching the Yet-to-be-Decided Congressional Races, Letitia James Melts Down
#self directed iraneo marxismletitia jamesbrics nationsclimate change hoaxcultural maoismdemocratic partydonald trumpelection fraudgeorge sorosgold and silveripccjerome corsikamala harris
00:35:31
06 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Trump Wins, GOP Headed Toward Senate & House Majority: What to Expect Next
#vibnopope francisnew york criminal sentencing2024 election resultsantifaarchbishop carlo maria viganòblack lives matterconstitutional amendmentdeep state conspiracydonald trumpeconomic collapseelectoral collegegods five stonesjeffrey epsteinjerome corsi
00:44:58
05 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Election Day Outlook and how Suspicious Voter Roll Algorithms in Some States May Come into Play
#nuclear warneo marxismkim brooksciaclimate changedemocratic partydonald trumpelection fraudga nerdsglobalismgooglejerome corsijoe roganjohn fettermankamala harris
00:34:11
01 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Breaking Down Abilities of Suspicious Algorithms in Some States’ Voter Roll Databases
#voter fraudpaulmillstone report9 11cochise countydeep statedepartment of justiceelection integritygovernment conspiracyjd vancejerome corsijfk assassinationkamala harrismail in ballotsmarxist leninistmerrick garland
00:36:15
29 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
A Swarm of Election Officials is Prepared to Spurn The Vote if Trump Wins
#silicon satanroe v wadereligious freedomadrian fontesarchbishop viganocleta mitchellclimate change denialconstitutional lawdonald trumpelection integrityfinancial crisisgold pricejerome corsijudge michael libertikamala harrisnew york timespope francis
00:39:19
28 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Trump's Historic MSG Rally; A New State Found with Corrupt Voter Roll Algorithms
#voter roll manipulationvoter registrationsuge knight2024 electionandrew paquettearchbishop viganoclone registrationsconstitutional crisisdemocratic partydonald trumpelection fraudgods five stonesjerome corsijohn boltonkamala harrisneoconservative war agendasrobert f kennedy
00:38:50
25 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
The Left Wants To Again 'Fortify' The Elections, Unless Trump Wins Big
#woke culturetruth centralreligious libertyciacultural marxismdeep state conspiracydonald trumpelection interferenceforeign policyjerome corsijfk assassinationkamala harrismaidan rebellionneo marxismnsaoctober 7th hamas attackspeter moray
00:39:25
24 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
How Corrupt Voter Roll Algorithms Can Be Used and the Globalist Left’s True Agenda
#voter roll algorithmsvoter fraudtruth centraladrian fontesamerican encoreandrew paquettebuilding 7chris gordaniconspiracy theoriescovid 19 vaccinescultural marxismdepartment of justicedonald trumpelection integrityjerome corsijfk assassinationkamala harrismichael liberdipolitical polarization
00:53:41
22 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Archbishop Vigano Endorses Trump in a Powerful Open Letter to American Catholics
#swiss americareligious freedommiddle east conflictbiden harris administrationbricscarlo maria viganòdeep statedonald trumpelection fraudglobal economic crisisgods five stonesgold investinghezbollahjerome corsikamala harrismichael snyder
00:29:13
21 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
List of States with Suspicious Voter Roll Database Algorithms Growing; Will Israel Attack Iran?
#venezuelaswiss americareligious conservatismbricsciaconspiracy theoriesdetroitdonald trumpelection integrityglobal economicsjerome corsijohn f kennedyjudge michael libertimiddle east conflictpope francis
00:34:44
18 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
The Philosophical Landscape of Informational Warfare and Enforcement of Election Integrity
#world economic forumvoter suppressionunited nationsaldous huxleyandrew paquettebarbara marx hubbardcultural marxismdulles brothersedward bernayselection integritygeorge orwellheartmath institutejean baudrillardjerome corsimind controlmkultranew world orderprescott bushstanley milgram
01:22:06
17 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Kamala's FOX Interview Disaster
#silicon satanreligious freedompope francisarchbishop viganobarack obamabill clintonbret baiercia conspiracycochise countydemocratic partydonald trumpelection fraudimmigration policyjerome corsijohn f kennedyjudge libertikamala harris
00:45:35
16 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Officials in States with Cryptographic Algorithms in Voter Rolls Are Not Taking the Problem Seriously
#wisconsinvoter registrationvolodymyr zelenskyadrian fontesdemocratic partyeconomic collapseelection fraudfrank larosegeorgia judgegodsfivestoneshawaiiinternational conflictjerome corsikamala harrisnew jerseynew yorkohiopennsylvaniasteganographyswiss americatexas
00:31:00
15 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Breaking: Pennsylvania Found to Have Suspicious Voter Roll Algorithm - A New Andrew Paquette Report
#voter registrationswiss americastate board of election idalgorithmic manipulationandrew paquettearizona 2020 electioncarlo maria viganòelection fraudjaccusejerome corsijudge michael j libertipennsylvania voter registrationpolitical conspiracypope francisreligious apostasy
00:30:31
14 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Democrats Reach New Levels of Desperation
#wisconsinvoter registrationukrainecultural maoismelection fraudgender identityglobal conflictgun rightsisrael hamas warjensidie itjerome corsikamala harriskiwi supermarketneo marxismnorth koreaoctober surprisepennsylvaniapolitical hypocrisysam elliottted walz
00:34:27
10 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
AZ Court Decision Strengthens Fight Against Corrupt Voter Roll Algorithms; Woodward" US Close to Nuclear War Under Biden
#nuclear war riskkamala harrisjfk assassinationamerican encore v adrian fontesarchbishop viganobiden harris administrationbob woodwardconspiracy theoriesdavid manticeconomic instabilityelection integrityequal protection clausefemagreen energy transitionhoward sterninternational energy agencyjerome corsi
00:31:59
09 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Updates on Research Into Corrupt Voter Roll Algorithms: A Conversation with Eric Metaxas
#voter registrationtruth centralreligious politics9 11 attacksandrew paquettecarlo maria viganòciaconspiracy theoriesdeep stateelection integrityeric metaxasjerome corsijfk assassinationkamala harrislee harvey oswaldmedia censorshipmike pompeo
00:36:30
08 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Al Gore's Climate Alarmism Rejected by His 'Mentor;' New Documentary Hones In on the Former 'VP's Flawed 'Science'
#vanderbilt divinity schoolthe climate according to aisherwood idsoal gorearrested by kamalaclimate changeearth in the balanceenvironmental hoaxjerome corsijoel gilbertkamala harrismedia censorshipopecour plundered planetpolitical hypocrisyrfk jrroger revelle
00:35:56
07 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Hillary Angry Over ‘Losing Control’ Without Social Media Censorship; Suspect Voter Roll Code Found in Battleground State
#war in ukrainevenezuelan gangsukraine warbiden administrationbric nationsdepartment of educationeconomic collapseelection integritygods five stonesgold standardhillary clintonhurricane miltonimmigration policyisrael iran conflictjerome corsisocial media censorship
00:28:33
04 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Are There Cloned Voter Registrations in Wisconsin? Why the Biden-Harris Pathetic Response to Helene?
#world war iiisocial issuesoperation paperclipbiden harris administrationclone votersconspiracy theorieseconomic collapseelection integrityelectric vehiclesfemageopolitical conflictgods five stoneshurricane heleneisrael iran conflictjerome corsijfk assassinationnew world order
00:37:51
03 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
'Arrested by Kamala - a Black Mother's Story' Documentary Creator Reveals Harris' Abuse of Power as CA AG
#truancy violationssickle cell anemiamaoist ideologyarrested by kamalabarack obamabarack obama birthcalifornia supreme courtcalifornia truancy lawscherie peoplesdemocratic party critiquefrank marshall davishomicide prosecutorsjerome corsijoel gilbertkamala harriskamala harris policiesmaoist
00:38:29
02 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Vance-Walz Debate: Analysis. Also, Will the Iran-Israel Conflict Lead to World War 3?
#wisconsin voter rollsvoter fraudtim walzatomic irancbp one appciaconspiracy theorieselection integritygeorge wallacegods five stonesisrael iran conflictjd vancejerome corsikamala harrisnsapolitical debatestiananmen square
00:30:58
01 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Update: Wisconsin Found to Have Suspicious Algorithm in its Voter Rolls: How to Stop the Real Steal
#ukrainian armysilicon satanoperation northern arrowsbricsconspiracy theorieselection integrityglobal economic crisishassan nasrallahisrael hamas warjerome corsijfk assassinationkamala harrislee harvey oswaldmike waltznatonuclear war
00:33:06
30 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
John Kerry to World Economic Forum and the UN: ‘We Don’t Need No Stinking First Amendment!’
#world economic forumvoter suppressionun general assemblybarack obamademocratic partyeconomic collapseelection fraudfirst amendmentglobalismgold rushjerome corsijfk assassinationjohn kerrymail in ballotsohio electionsp diddy
00:26:56
27 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
The Deep State Comes Down on Eric Adams; Harris to Suffer Fallout After Disastrous Softball Interview
#united nationsswiss americastephanie ruhledeep state conspiracydemographic declineeconomic collapseelection integrityeric adamsford motor companyjerome corsijoe bidenkamala harrismsnbcnatonuclear warohio secretary of staterussia
00:34:48
26 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
What, Legally, Can Be Done About Suspicious Algorithms in Several States’ Voter Rolls: An Attorney’s Perspective
#voter registration fraudtom renzthe truth centralalgorithmic manipulationciaelection interferencefranklin laroseharvardjerome corsimail in ballot securitymail in votesmodular arithmeticnew jerseynew yorkohioohio attorney generalpolitical pressure
00:44:38
25 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Suspicious Algorithms in Several States’ Voter Rolls: How Did They Get There and Why? - with Tony Shaffer
#voter registrationtony schafferohiociadeep statedodelection integrityforensic auditsghost votersintelligence agenciesjerome corsijim clapperjohn brennanmail in ballot fraudnew yorknsa
00:53:19
24 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
The UN Doubles Down on Agenda 2030; Blinken Hints at Elevating Proxy War vs. Russia
#united nationsukraine russia warthetruthcentralagenda 2030antony blinkeneconomic collapseglobalist elitesgods five stonesgold and silverisrael hezbollah conflictjerome corsikamala harrislloyd austinmiddle east conflictnational debtnew world governmentpact for the future
00:28:55
23 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
Potentially Corrupt Algorithms Found in More States’ Voter Rolls: An Update
#vote harvestingtulsa oklahomap diddy scandalagenda 2030andrew paquettecnnconspiracy theoriesdepartment of justiceeducation reformelection integrityfinancial crisisforeign policyghost votersgods five stoneshamashillary clintonisrael hezbollah conflictjerome corsinew york times
00:37:19
20 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Behind the Kamala Harris Money Machine
#voter registration filesus intelligence agenciestransgender rightsbarack obamaburberry clothingclimate change policyelection integrityfinancial crisisgavin newsomgold investmenthillary clintonjerome corsikamala harrismark buellpolitical corruption
00:44:56
19 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
How Will Escalating Conflicts Worldwide Affect the 2024 U.S. Elections?
#yanukovychukraine conflictpope francis2024 us electionantifaclinton foundationdemocratic partydonald trumpgeopoliticsgods five stoneshezbollahiranisraelisrael hamas warjerome corsijoe bidenkamala harrismaidan rebellionpetro poroshenko
00:31:33
18 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
New Updates on Ohio's Investigation into a Corrupt Algorithm Within its Official Voter Database
#voter fraudthetruthcentralreligious extremismandrew paquettebiden administrationciademocratic partyelection integritygods five stonesjerome corsikamala harrismedia biasnew world orderohio voter databasepolitical conspiracy
00:31:46
16 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
Update on Ohio Corrupt Voter Roll Algorithm Investigation; Another Possible Attempt on Trump’s Life
#walking liberty half dollarvoter fraudthetruthcentralandrew paquetteconspiracy theoriesdonald trumpeconomic collapseelection integritygeopolitical conflictghost votershenry kissingerjerome corsikamala harrisnatonew jerseynew yorknsm 200ohiopolitical assassinationryan wesley ruth
00:25:13
13 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Is the CIA Controlling our Elections? Dr Jerome Corsi's Conversation with His Glory: Take Five
#world economic forumvoter fraudtruth centralbill gatesciacritical race theorydemocratic partyelection integritygods five stonesgovernment conspiracyhenry kissingerjerome corsinational security memorandum 200new jerseynew world ordernew yorkoblaconunmdohiooklahomapennsylvania
00:23:33
12 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
More on a Discovered Corrupt Voter Roll Algorithm in Ohio: Dr. Corsi Town Hall
#voter fraudsaddam husseinpolitical corruptionandrew paquetteanthony faucibuilding 7conspiracy theoriesdeep stateelection integrityfrank larosehelp america vote actjerome corsijfk assassinationlyndon johnsonnational security memorandum 200operation mockingbirdpentagon papers
01:13:10
11 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Corrupt Algorithm Found in Ohio: Suspicious Activity Suspected; Plus Post-Debate Analysis
#political polarizationohio voter registration databasenew world order9 11 attacksconspiracy theoriescultural maoismcultural marxismdavid mantekdavid muirdeep state allegationselection integritygods five stonesjerome corsijfk assassinationkamala harrislee harvey oswaldneo marxism
00:23:15
10 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
Heading Back to Ohio as Investigations into Suspicious Voter Roll Algorithms Heat Up
#world economic forumvoter roll algorithmstranshumanism9 11 attacksanti globalist movementcaliforniadaniel estulindonald trumpelection fraudfloridagods five stonesiraq warjerome corsikamala harrisklaus schwabnew world ordernew york stateoklahomatexasthe truth central
00:48:22
09 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
Where Dr. Corsi's Probe into Suspicious Voter Roll Algorithms in Several States is and What's Next
#voter registrationtulsathe truth centralandrew paquetteciaconspiracy theoriescurtis lemaydemocratic partydonald trumpelection fraudgeorge wallaceglobalismgods5stonescomjerome corsikamala harrisnew yorkoklahomapolitical polarization
00:30:04
06 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Probing the Dangerous Voter Roll Algorithms in Several States: More on The Real Steal
#voter roll algorithmsvoter fraudthe truth centralbrian katzchris cordanidata analysiselection integritygods5stonescomhuron countyjerome corsijosh jessemahoning countymail in ballot fraudmail in ballotsohio board of electionsohio electionsreal steel
00:06:17
03 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
Ohio Opens OFFICIAL INVESTIGATION into Suspicious Voter Roll Algorithm
#weapons of mass destructionvoter registrationtulsa oklahoma9 11 attacksandrew paquetteciaconspiracy theoriesdeep stateelection fraudghost votersjerome corsijohn f kennedynew york state board of electionsohio secretary of statepolitical manipulationthe war on humanity
00:23:15
29 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
The JFK Assassination, the Russian Collusion Hoax and the Deep State's Manipulative Agenda (encore)
#victoria nulandvatican iithe truth centralarchbishop viganobruce ohrchristopher steeleconspiracy theoriesdeep statejerome corsijohn f kennedyjohn mccainmedia censorshipmichael isikoffmueller investigationnew world orderpolitical corruptionrobert kaganseth richsteele dossier
00:46:03
27 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
The Truth About the #JFK Assassination: The Medical Cover-Up (encore)
#texas school book depositoryparkland hospitalmedical forensics9 11 conspiracyair force onebethesda autopsyciaconspiracy theoriesdavid mantikdr boswelldr james humesfbi agents silbert and oneillgovernment cover upsjerome corsijfk assassinationjohn f kennedylee harvey oswald
00:40:22
26 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Focusing in on Screenshots and Witness Accounts of #JFK's Assassination and Evidence of the Massive Coverup
#x raystransgender ideologythe truth centralabortionalan dullesconspiracy theoriesgeorge sorosgovernment cover upsgrassy knollhillary clintonjerome corsijfk assassinationjoe bidenjohn f kennedylee harvey oswaldnicholas katzenbachpolitical corruptionreligious conservatism
00:47:23
23 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
The Deep State, Suspicious Voter Roll Algorithms and the Anti-Globalist Manifesto A Conversation with Stern America
#voter roll algorithmsvoter registration fraudthe anti globalist manifestoanti globalismdeath valleydonald trumpelection integritygods5stonescomhsbc money launderingjerome corsikamala harrislaroseohio state board of electionspolitical conspiracy theoriessecond amendment rights
00:11:27
20 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
Exposing Potential Election Interference Through a Voter Roll Algorithm in Oho: Q & A with Dr. Corsi
#voter registration fraudohio voter registration databaselao xialgorithmic manipulationanti globalist allianceanti globalist movementbarack obama birth certificatecalabresedavid manningdeep state conspiracydominion voting machineselection integrityfrank larosegods5stonescomjerome corsijohn f kennedy assassinationjulian assangekamala harris
01:02:26
19 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Update on the Ohio Voter Roll Algorithm and Election Interference Potential with The Resistance Chicks
#woke ideologyvoter registrationthe truth central2020 electionalgorithmic manipulationandrew paquettebarack obamaelection fraudfrank laroseghost votersjerome corsikamala harrisnew york study groupohioreligious rhetoricrepunitsresistance chicks rumble
00:58:14
15 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
The Real Steal: Dr. Corsi Town Hall on Dangerous Voter Roll Algorithms in Some US States (Live 8/14/24, Medina, OH)
#voter registrationnsamike laroseanthony paquettebrad raffenspergerciaconspiracy theoriescryptographic algorithmsdominion voting systemsdonald trumpelection fraudguides5stonescomjerome corsijfk assassinationkamala harrisken blackwellmail in ballots
01:27:08
14 Aug
Wed
The Truth Centra...
Dr. Jerome Corsi
The Neo-Marxist Foundations of Today’s Woke Culture
#woke culturewilliam z fosterthe truth centralbarack obamabella doddbernadine dornbill ayerseconomic collapsefrank marshall davishouse un american activities committeejerome corsimarxist conspiracyneo marxismpaul robesonpoliticalcompolitical infiltrationsystemic racism
00:39:26
12 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Starvation as a Political Weapon: The Dark History of Marxism (encore)
#world economic forumrobert muellerproposition 47christopher wraycultural revolutiondemocratic party corruptiondonald trumpeconomic crisiselection interferenceelon muskjerome corsijoe bidenjohn durhamjulian assangemar a lagomedia biasneo marxismpolitical indictments
00:43:28
09 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
Tim Walz’s Stolen Valor Makes Him Unfit to be VP
#world economic forumvoter fraudtim walzbarack obamabill gatescatholic churchconspiracy theoriesdonald trumpjd vancejerome corsijohn f kennedykamala harrisklaus schwabpolitical corruptionreligious rhetoricstolen valorthird secret of fatima
00:28:52
08 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
The Best of Dr. Corsi: The Deep State and the Deep Church: Behind Archbishop Vigano’s Stand Against Pope Francis
#vatican coupthe case to impeach and imprison joe bidenpope francisarchbishop carlo maria viganòbarack obamacardinal theodore mccarrickcatholic churchconspiracy theoriesdeep statedenis mcdonoughgeorge soroshillary clintonhunter biden laptopjerome corsijoe bidenmike mccormickpolitical corruption
00:59:42
07 Aug
Wed
The Truth Centra...
Dr. Jerome Corsi
Honing in on Another State With a Suspicious Voter Roll Algorithm
#voter fraudohionew york state board of elections2024 electionandrew pickettarthur morelloclone voterscripdata manipulationecho voterselection integritygopjerome corsikamala harrismail in ballots
00:19:37
06 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
Iran Pledges Retaliation Against Israel: What to Expect; The Kamala Honeymoon will Soon be Over
#voter fraud allegationsthe truth centralpennsylvania voter fraud2024 us electionanti globalist manifestodemocratic party criticismdonald trumpeconomic collapsegods five stoneshunter bideniranian retaliationiran israel conflictjerome corsijoe bidenkamala harrisnew york voter fraudohio voter fraud
00:21:35
05 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
US Markets, Nikkei Plummets: Is a Global Market Collapse Coming?
#volodymyr zelenskyswiss americasharia lawanti globalist alliancebiden administrationdeep stateelection integrity claimsglobal stock market crashgods five stonesgold and silver investinghyperinflation risksjerome corsijfk assassinationkamala harrisnational debtnikkeipolitical conspiracy theoriesreligious end times
00:25:01
02 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
Another #WokeLympics Debacle: #IOC Defends Biological Men Pummeling Women for Sport
#woke ideologysheila jackson leereligious fundamentalismanti globalist alliancebill clintonchrisconspiracy theoriesequal rights amendmentgazagender identityiocisrael hamas warjerome corsijuanita broderickkamala harrismonica lewinskynicolás madurophyllis schlaflypolitical corruption
00:34:47
01 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
More Proof the Secret Service Lied About Trump Assassination Attempt as New Video Released Showing Shooter Walking on Roof Before Attack
#zelenko protocolssilicon satansecret serviceanti globalist alliancearchbishop viganobarack obamaconspiracy theoriesdonald trumpgods five stonesjerome corsikamala harrismkultranational association of black journalistsnikki haleyopportunity zonespope francis
00:33:43
31 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
More Secret Service Weaknesses Exposed Over the Trump Assassination Attempt
#ted cruzsecret service corruptionsecret servicebarack obamablackrockciaconspiracy theoriesdonald trumpeconomic collapsehamashezbollahisraeljerome corsijfk assassinationjoe bidenkamala harrismiddle east conflictpolitical assassinationsrobert f kennedy jr
00:31:27
29 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
The Coronation of Kamala and Biden's SCOTUS Sore Loser Plan
#tony molinarithe truth centralswiss americaandrew paquetteat riskbarack obamaciademocratic national conventiondonald trumpeconomic collapseelection fraudglobalismgods five stonesjerome corsikamala harrismodern monetary theorysecret service negligence
00:39:03
25 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Biden's Awkward Address to the Nation; Pro-Hamas Protesters Cause Chaos in Washington
#zero hedgeunion stationswiss americaandrew paquettebricscovid 19 conspiracyeconomic collapsegods five stonesgold investingisrael hamas warjerome corsijoe bidenkamala harriskyle dean gravespolitical corruption
00:20:18
24 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
The Democrats’ Kamala Albatross More Questions Rise Over Trump Assassination Attempt
#ziko protocolsthe truth centralsecret serviceantifaassassination attemptbarack obamablack lives matterbrics nationsdeep state theorydei initiativeseconomic collapseelection fraudend times prophecyfetal tissuejerome corsijfk assassinationkamala harrismail in votingn5h1pandemic conspiracy
00:27:55
23 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
The Democrats are Stuck with Kamala Harris; The Secret Service Chief Gets Grilled from Both Sides
#swiss americapolitical corruptionkamala harris2 chronicles 7 14barack obamabird flublack lives matterbutler rallyconspiracy theoriesdeep stateelection integrityfinancial collapseglobalismhillary clintonjerome corsijfk assassinationjoe biden
00:29:46
19 Jul
Fri
The Truth Centra...
Dr. Jerome Corsi
What are the Democrats’ Plans for the DNC and November?
#world war iiisecret servicereligious politics25th amendmentazithromycinconspiracy theoriescovid 19donald trumpelection fraudgetrxmedsnowcomgods five stoneshydroxychloroquinejerome corsijfk assassinationkamala harrispandemic conspiraciespolitical corruption
00:28:52
18 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Is the End for Biden's Campaign Near? EU Globalists in a Tizzy over Orban's Meeting with Putin
#steve bannonroe v wadereligious extremismanti globalist manifestobricsconspiracy theoriescovid 19democratic partydonald trumpeconomic collapsegazajd vancejerome corsijfk assassinationkiwimedical misinformationpolitical corruptionpope francis
00:32:50
16 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
More Questions Surround Trump Assassination Attempt; Biden Blames Trump for Violent Political Rhetoric
#ukraine warsecret servicerobert f kennedy jrbiden administrationconspiracy theoriesdeep statedonald trumpeconomic collapsefederal reservegold and silverinternational corruptionjd vancejerome corsimike pencepolitical assassination
00:32:03
11 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Did the Deep State and the Deep Church Accommodate Drug and Child Trafficking Out of Honduras?
#vatican scandalsinaloa cartelpope francisalliance for prosperityarchbishop viganobarack obamacardinal mccarrickchild sex traffickingdeep statedennis mcdonoughdrug traffickinggeneral john f kellyjerome corsijoe bidenjuan orlando hernandezmike mccormickpolitical corruption
00:47:45
10 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
Calls for Biden to Step Down Mount; The CCP Conducts Military Exercises Near Ukraine Border
#zelenskytruth centralsinaloa cartelarchbishop viganobelaruschinaconspiracy theorieseconomic collapseel chapogeopolitical conflictgods five stonesjerome corsijoe bidennatoparkinsons diseasepeter doocypolitical corruptionpope francisreligious extremism
00:36:40
08 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
Top Dems Behind the Scenes Look to Dump Biden; A Deeper Look into the UK, France Election Results
#voter frauduk labour partypope francis2024 us election25th amendmentbird fluboeingdeep state conspiracyeconomic collapseelection integrityglobal pandemicgreen new dealjerome corsijoe bidenkamala harrisnatonuclear war
00:28:07
03 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
The Deep State and the Deep Church: Behind Archbishop Vigano’s Stand Against Pope Francis
#xi jinpingukrainetreasonalliance for prosperitycarlo maria viganòcatholic churchconspiracy theoriesdeep stategeorge soroshillary clintonhondurasimpeachmentjerome corsijoe bidenjuan orlando hernandezmike mccormickpope francistheodore mccarrick
01:00:40
01 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
Why the Democrats Will Not Dump Biden
#valerie jarrettsusan ricesteve bannonarchbishop viganobarack obamabjorn lomborgclaudine gaycritical race theorydeep state conspiracyend times theologygreen energy transitionjanuary 6th committeejerome corsijfk assassinationjoe bidenjulian assangekathy hochulmarine le pennational rallypope francis
00:43:34
28 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
Post Trump-Biden Debate Analysis; Archbishop Vigano Issues a Huge Statement
#vatican synodreligious freedompresidential competence25th amendmentcarlo maria viganòcnn debatedeep statedemocratic party corruptiondonald trumphunter bidenjeffrey epsteinjerome corsijoe bidenkamala harrislegal challengespizzagatepope francis
00:42:49
27 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
The Service and Sacrifice of Gen. Michael Flynn with Scott Wiper, Creator & Director of FLYNN
#the truth centralsidney powellscott wiperdeep statedefense intelligence agencydocumentary filmmakingfbi entrapmentflynn the moviegeneral michael flynnjerome corsijulian assangemichael flynnmueller investigationperpetual warrussiagate
00:52:31
26 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
Anti-Israel Squad Member Loses Primary; A Deeper Look into NY's Voting Role Algorithm
#spiral cipherrussia ukraine warnew york citizens auditandrew paquettecheap fakesdeep fakeselection fraudfederal reserveglobal economic collapseho chi minh offensiveisrael hamas warjamal bowmanjerome corsijohn kerrykenya diaper riotslatimer
00:51:25
19 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
What Really Happened at the Hunter Biden Trial From Someone Who Was There - with Mike McCormick
#wilmington delawarevictoria nulandpolitical corruptionbarack obamabribery allegationsburismaconspiracy theoriesdavid weisseric holderhunter bidenhunter biden trialjake sullivanjeffrey pyattjerome corsijoe bidenmedia censorshipmetabiotamike mccormick
00:43:49
18 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Why is there an Algorithm in the New York State Board of Elections Voter Roll and WHO Put it there? with Andrew Paquette
#voter fraudsteganographyrep units338000 illegal registrationsaid numbersalgorithmic analysisallegheny countyandrew paquettecaesar cipherdata manipulationelection integrityjerome corsimail in ballotsmp voter casenew york state board of electionsnyca
01:31:03
17 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Biden Freezes On Stage: Is the End of His Re-Election Campaign Nigh?
#world war iiiworld economic forumreligious fundamentalismbenjamin netanyahuclimate change denialclub of romeconspiracy theoriesdeep stategavin newsomgeopolitical conflicthenry kissingerjack rubyjerome corsijfk assassinationjoe bidenjulian assangekamala harrisnatopolitical corruption
00:41:17
11 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
EU Voters Take Down Globalists, Climate Alarmists; Why the World Let's Iran Destroy the Middle East
#the anti globalist alliance manifestosudan starvationreligious worldviewchina russia conflictconspiracy theoriesdepopulation agendadr mantikgetrxmedsnowglobal conflictgreen partieshamashezbollahiranjerome corsijoe bidenkamala harrislee harvey oswaldmiddle east warpolitical polarizationpresidential health
00:26:56
07 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
The Biden Administration’s Latest Political Stunt Targets Steve Bannon
#world war iiiukraine russia wartranshumanismbiden administrationbill gateschina pakistan relationsdavid mattisdonald trumpeconomic recessionjanuary 6th committeejerome corsijulian assangekaja kallaskharkovkievlawfarenational debtsaudi arabiasteve bannonswiss america
00:39:24
06 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
What will Really Come Out of the Hunter Biden Show Trial?
#zero emission vehiclesrosemont senecaroe v wadebohai llcdemocratic party corruptiondepartment of justicedonald trumpeconomic declineglobalist plotshunter bidenhunter biden prosecutionjames bidenjerome corsijfk assassinationkevin mccarthymike johnsonneo marxism
00:48:05
04 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Exposing the Climate Change Agenda and its Masters' True Intentions with Brian Sussman, Author of #ClimateCult
#steven novellarachel carsonmilgram experimentaocbrian sussmanclimate changeclimate cultclimategatedan rathereco tyrannyenvironmental movementfrederick engelsgreen energyjerome corsimarxist ideologymass formationmichael mann
01:00:24
31 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Trump Convicted in Stalinesque Show Trial: Did the Left Just Hand Him the 2024 Election?
#vladimir putinukraine warthe anti globalist alliance manifestoalan dershowitzalvin braggbostondeep statedeep state conspiracydonald trumpdonald trump convictioneconomic declinegeorge sorosjerome corsijoe bidenmichelle wunatoreligious fundamentalism
00:43:02
29 May
Wed
The Truth Centra...
Dr. Jerome Corsi
DeNiro's Meltdown and the Desperation of the Biden-Harris Campaign
#warren commissionthe truth centralsaul alinskybiden harris campaigncamp cupcakeclimate change denialconspiracy theoriesdeep statedonald trumpgeorge sorosglobal economic collapsehunter bidenjanuary 6th insurrectionjerome corsijfk assassinationjoe bidenrobert de niro
00:37:04
28 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Biden's Israel-Hamas Political Conundrum; Dems Pin Hopes on Trump Hush Money Trial
#zelenskynuclear war risknsaciaclimate change policydeep statedeep state conspiracydonald trumpgold rushisrael hamas conflictjerome corsijfk assassinationjoe bidenlawfare strategyneo nazinet zero goals
00:38:53
24 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Big Bronx Trump Rally Worries Dems; Putin Wants a Ceasefire in Ukraine?
#zelenskyvictoria nulandukraine waranthony blinkenanti globalist alliancedeep statedei programsdonald trumpeconomic collapsefbi raidgender identityjerome corsijfk assassinationlee harvey oswaldmar a lagoputinsarah netburntrump administration
00:53:28
23 May
Thu
The Truth Centra...
Dr. Jerome Corsi
Behind the Biden Administration's Authorization of Use of Deadly Force for Trump Home Raid
#vaccine safetysupreme courtrobert kennedy jrbiden administrationbill gatesbreonna taylordeep state conspiracydonald trumpdr manticeconomic collapseedward fogartyjerome corsijfk assassinationlee harvey oswaldlipid nanoparticlesmar a lagonoah hararinuclear warpfizerreligious freedom
00:38:30
22 May
Wed
The Truth Centra...
Dr. Jerome Corsi
The Untold Stories of Ashli Babbitt and the Women of January 6th with Jack Cashill
#world economic forumroseanne boylanray eppsantifaantifa activismashley babbittblack lives matterbrian sicknickconspiracy theoriesdonald trumpgeorge floydgovernment cover upjack cashilljanuary 6th insurrectionjerome corsilila morrismarxist revolutionmichael byrdnew world orderpolitical polarization
00:59:12
21 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Families Can Not Keep Up with Biden's Inflation; How Lawfare Against Trump Made the Former President a Hero
#transgender rightssupreme courtnetanyahu14th amendmentbill gatesdeep state conspiracydonald trumpebrahim raisiglobal financial crisisgold investinghamasinternational criminal courtjanuary 6th insurrectionjerome corsijfk assassinationjoe bidenklaus schwablawfare prosecutionslgbtq agenda
00:44:54
17 May
Fri
The Truth Centra...
Dr. Jerome Corsi
The Lunacy of World Government, the WHO Pandemic Power Grab and Marxist DEI
#world health organizationwoke ideologytedros adhanom ghebreyesusanti globalist alliance manifestobill gatesclimate change denialconspiracy theoriesfinancial collapseglobal health governancejasmine crockettjerome corsiklaus schwablee harvey oswaldmarjorie taylor greenemarxist educationmichael cohensilent no moresteele dossier
00:42:50
16 May
Thu
The Truth Centra...
Dr. Jerome Corsi
The West Using War to Finance Debts? Biden vs. Trump is On -- With Biden Camp Restrictions
#warren commissionvolodymyr zelenskyukraine conflictcyril weckdeep state conspiracydonald trumpgeorge soroshamasiranisrael hamas warjerome corsijfk assassinationjoe bidenlee harvey oswaldmartin armstrongmichelle obamanew world orderpresidential debatesrobert kennedy jr
00:45:02
10 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Biden's Economic Fantasy World; Why the War on Israel is a War on the West
#woke insanityvladimir putinukraine conflictbric nationsciacultural maoismcultural marxismdeep statedonald trumpeconomic collapseiranisrael hamas warjerome corsijoe bidenmedia manipulationnatothe anti globalist alliance manifesto
00:41:50
08 May
Wed
The Truth Centra...
Dr. Jerome Corsi
Mishandling of Evidence Bombshell Postpones #Trump Docs Case; Why Ukraine War Funding is Far From Over
#who really killed kennedyukraine wartesla2 chronicles 7 14conspiracy theoriesdeep stateeconomic collapseelon muskforeign policyhamasiranjack smithjerome corsipolitical corruptionreligious fundamentalismrobert kennedy jrswiss america
00:47:26
07 May
Tue
The Truth Centra...
Dr. Jerome Corsi
The Biden Administration’s #Economic Mentality and Modern Monetary Theory; #Israel Poised to Take #Rafah
#yasser arafatstudent protestsnew world orderayatollah khomeinibeattruthcentralbill gatescolumbia universityconspiracy theoriescouncil of economic advisorseconomic collapsehamasjared bernsteinjerome corsijfk assassinationjoe bidenklaus schwabmodern monetary theorymuslim brotherhoodneo marxism
00:49:13
03 May
Fri
The Truth Centra...
Dr. Jerome Corsi
The Truth About the College Pro-Hamas #Protests; #Avenatti Comes Clean About #Trump Shakedown
#world economic forumwar room bookstruth centralanti globalist alliance manifestobill gatesbrown brothers harrimanclimate change denialconspiracy theoriesdulles brothersglobal elitejerome corsijfk assassinationklaus schwabmike pompeonew world ordernew york timesprescott bushsteve bannontranshumanism
00:47:18
02 May
Thu
The Truth Centra...
Dr. Jerome Corsi
Hamas is Playing the US, West as Fools; Will the Dems Orchestrate a 1968 Redux?
#us electionsukraine warnatoanti globalist alliance manifestoatacms missilesbannons war roombassam tawilciaconspiracy theoriescuban missile crisisdeep statefrom the river to the seagetrxmedsnowhubert humphreyisrael hamas conflictjerome corsijohn f kennedylee harvey oswaldmilitary industrial complex
00:43:09
01 May
Wed
The Truth Centra...
Dr. Jerome Corsi
Why Campus #Protests Are Getting Worse; #NATO Prepares for Face-Off with #Putin
#yanukovychukraine conflictukraineanti globalist allianceanti semitismburismaconspiracy theoriesfederal reservegeorge sorosglobal economic crisishamashunter bidenisrael hamas warjerome corsijohn f kennedynatonato military exercisesrussiastudent proteststruthcentral
00:32:02
30 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
While Biden's Gaffes Crack Us Up, The Counter-State is Destroying America
#the final analysisroe v wademartin luther king jrbiden administrationclimate changeconspiracy theoriesdeep stateforeign policygender ideologygeorge sorosgrassy knollgreen new dealjerome corsijohn f kennedylee harvey oswald
00:46:47
29 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
U.S. Colleges Are Grooming Terrorists; Why #NATO Continues to Artificially Prop up #Ukraine?
#zelenskyukraine warthe final analysisciadeep state conspiracyeconomic collapsegeorge soroshamashunter bidenjerome corsijfk assassinationjoe bidenlee harvey oswaldmaidan coupmiddle east conflictmilitary industrial complexnatorussia
00:33:55
26 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
The Alvin Bragg Embarrassment Worsens; Has the Deep State Become a Counter-State?
#ukrainethetruthcentraltaiwanalvin braggbiden administrationclimate policydeep statedonald trumpeconomic collapseepaforeign aidharvey weinsteinisraeljerome corsijpmorganlawfarenatonew york timesreligious moralityshugerman
00:44:31
22 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Jamie Dimon's Warning to the #FederalReserve; #Ukraine Gets Big Bucks as Johnson Caves
#william burnswells fargovolodymyr zelenskyarchbishop viganocitigroupconspiracy theorieseconomic crisisiranisraelisrael iran conflictjamie dimonjerome corsijohn f kennedyneo marxismproject aquareligious extremismseymour hershukraine war
00:30:35
18 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Unbiased Jurors Scarce for #Trump Trial; Dems Desperate #Election2024 Strategy
#religious fundamentalismpolitical persecutionnew york hush money trialciaconspiracy theoriescultural marxismdonald trumpeconomic collapsefrankfurt schoolgold pricesgooglehamashillary clintonjerome corsijoe bidenjohn f kennedylee harvey oswald
00:50:51
17 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Will Israel Attack Iran? The Spying Power-Up Hidden in the FISA Re-Authorization
#world war iiithetruthcentralopen bordersbiden administrationcultural revolutiondavid camerondonald trumpeconomic collapseeuropean court of human rightsfisa reauthorizationgovernment surveillanceiranisraelisrael iran warjerome corsilawfaremahdinsa
00:48:20
15 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Trump Makes History with the Hush Money Trial as Jury Selection Begins
#woke ideologiestransgender rightsreligious revivalbidenomicsciaconspiracy theoriesdeep statedonald trumpeconomic collapsehamasiran israel warjerome corsijoe bidenjohn f kennedylee harvey oswaldmiddle east conflictpolitical corruption
00:41:31
11 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Over 3 Years of #Bidenomics: What the Media Doesn't Want You to Know; Iran Preps to Attack Israel
#the final analysisprescott bushnatobiden administrationblackrockciadavid manticdeep statedeep state conspiracyesg fundsesg investment crisisgreen energyiran israel warisrael iran conflictjerome corsijfk assassinationjfk skull x raysjohn foster dullesmercury bullets
00:41:30
10 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
The Let's New Stealth Mail-In Ballot Plan; Biden's Attempts to Buy the Gen Z Vote
#world economic forumwoke ideologyvoter frauddetroiteconomic crisisgaza wargovernment overreachjerome corsijfk assassinationjoe bidenjohn f kennedymodern monetary theoryst louissupreme courtthetruthcentralus marshals
00:43:33
08 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Where America is Now and a Message of Hope for Our Country with Gen. Mike Flynn
#weapons of mass destructionunipartymichael flynncolin powellconspiracy theoriesfifth generation warfareflynn deliver the truthgovernment deceptiongulf of tonkinhsbcjerome corsijfk assassinationjulian assangelee harvey oswaldmedia censorship
00:41:03
04 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Deep State Comes After Trump's, Musk's Assets; Is NATO on the Verge of Breaking Up?
#warren commissiontransgender day of visibilitynato crisis14th amendmentaisha siddiqaclimate change denialconspiracy theoriesdeep statedonald trumpeconomic collapseelon muskface lawfrankfurt schoolgoldjerome corsijfk assassinationjoe bidenjohn f kennedynato
00:53:16
03 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Focusing in on Screenshots and Witness Accounts of #JFK's Assassination and Evidence of the Massive Coverup
#woke neo marxistswarren commissionukraine warciaconspiracy theoriesdavid manticgovernment cover upgrassy knolljerome corsijfk assassinationjohn f kennedylee harvey oswaldmichael chesternational archivesnato expansionnicholas katzenbachpolitical polarizationreligious extremismthetruthcentralcom
00:47:32
02 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Prison Terms for Hate Speech? California's $1.6 Trillion Debt
#woke ideologyukraine conflictneo marxismcalifornia debtciaclimate change denialconspiracy theoriesdeep stateelectric vehicleshavana syndromeisisjerome corsijoe bidenjohn fitzgerald kennedylee harvey oswaldlgbt rightsnato
00:48:48
27 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
Questions Raised About the Baltimore Bridge Collapse; The Men Behind JFK's Assassination
#world war iiiwall streetnational archivesconspiracy theoriesdavid mantikadeep statedonald trumpdulles brothersfrancis scott key bridgeglobal new world ordergreat replacementjerome corsijfk assassinationjoe bidenjohn f kennedylee harvey oswaldmichael flynn
00:55:59
26 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
#Baltimore in Disarray After Key #BridgeCollapse; US-#Israel Relations Deteriorating After UNSC Gaza Vote
#world war iiiukraine conflictreligious fundamentalismbenjamin netanyahubiden administrationclimate change denialconspiracy theoriescrime and punishmentdefund the policeforeign policyfrancis scott key bridgegreen energy agendaipccisrael hamas warjerome corsijohn f kennedypolitical corruptionpost modernism
00:35:58
25 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
Excessive Money-Printing: The Fuel of Our Current World Chaos
#unrwaunited airlinesthe final analysisbethesda naval hospitalbric nationsciacultural wardavid manticdeep state conspiracydepartment of justiceeconomic collapseglobal governancehouthi attackshunter bidenjerome corsijfk assassinationlee harvey oswaldparkland hospitalscott kirby
00:48:11
21 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
Impeachment Inquiry Exposed 'Big Guy' #Biden; A Primer on New 'News-Speak' Gaslighting
#truth centralroe v wadejoe bidenbiden impeachmentchinese communist partyclimate change policycultural decaydefense department reporteconomic declineeuropean climate changehunter bidenillinois healthcarejerome corsijfk assassinationjim jordan
00:35:54
20 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
Supreme Court Hands Texas Big Border Win; Will a #Biden Impeachment Actually Happen?
#ukraine warpeter navarropentagonamazonanthropocene epochciaclimate changedavid manticgooglegrassy knollgreat replacement theoryhunter bidenjanuary 6th committeejerome corsijfk assassinationjoe bidenlee harvey oswaldmicrosoftnew york times
00:53:39
19 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
Putin's Warns of World War 3 if NATO Sends Troops to Ukraine; Trump Prosecutor in a Legal Conundrum
#warren commissionvladimir putinukraine war9 11conspiracy theoriescultural conservatismdeep statedonald trump trialeconomic crisisjack smithjerome corsijfk assassinationjoe bidenjudge eileen cannonkamala harrislee harvey oswaldnatopresidential records actthe final analysis
00:49:45
18 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
How Texas Could Truly Secure the Border; Biden Doubles Down on Net Zero Rules
#the final analysisterrablock barrierslee harvey oswaldassassination plotsbiden administrationblack swan eventscarlo maria viganòciaconspiracy theoriesdepartment of justiceeconomic collapseelon muskfbiglobalismgovernment corruptionjerome corsijohn f kennedy
00:51:08
15 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
Schumer Demands New Israel Election; Toronto Police Honcho Says 'Make Car Thefts More Convenient'
#yuval hararithe truth about energythe final analysisabortion rightsbenjamin netanyahuchuck schumerelectric vehiclesglobal warminggold investmenthamasisrael gaza conflictjerome corsijfk assassinationjohn f kennedyklaus schwablee harvey oswaldmalcolm perryrafahricciardi
00:53:01
11 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
Are France and the UK Sowing the Seeds for War? Shocking New JFK Assassination Revelations
#nuclear warlee harvey oswaldklaus schwabalan dawesbill gatesciaconspiracy theoriescritical race theorycuban missile crisiscultural marxismdavid manticgeorge sorosglobal resetgreat resetjerome corsijfk assassination
00:30:52
07 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
Where Woke Came From and Where it's Going pt 8: Hegel, Boehme and Pseudo-Reality
#victoria nulandukraine conflictsuper tuesdayantony blinkenarchbishop viganobill gateschicagocommercial real estate crisisconsumer debtcritical race theorydarien gapelaine chaofani willisfederal reservefiat money collapsegeorge sorosglobal conspiracy theoriesgold priceshouthi attacksjerome corsilondon breedmitch mcconnellnikki haleyopen border policiesron paul
00:53:12
06 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
The Truth About Weaponized Migration; How the Fed is Responsible for the U.S. Debt Crises
#victoria nulandron paulpolitical corruptionarchbishop viganobiden administrationchicago gang violenceeconomic collapseelaine chaofederal reservegeorge sorosgold investmenthouthisjerome corsimitch mcconnellopen border policies
00:53:12
01 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
Pentagon Warns of War with Russia if Ukraine Falls; Obama Tries to Spy on Trump Again
#ukraine conflictukrainetrump campaignciaclimate changecoup detatdeidemocratic corruptiongender identityjerome corsikathy hochullloyd austinmike johnsonnatonato russia warneo marxismobamapentagonrobert shermanrussia
00:38:15
29 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
Don't Be Fooled by Fake Bidenomics 'Growth,' World War Worries and Apple's EV Plan Fails
#world economic forumvladimir putinukrainearchbishop viganoeconomic declinefederal reservegeorge sorosglobalist conspiracygreen energy failurehunter bidenhunter biden testimonyjerome corsijoe bidenjoe biden healthjonathan leemodern monetary theorynatonato expansionrussian oligarchstucker carlson
00:45:28
28 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
The Butterfly Effect, Junk Science, Critical Theory and Woke Gaslighting
#world economic forumthetruthcentralmarxist cultural revolutionbezvinovbill gatesbutterfly effectcarbon dioxidecarlo maria viganòclimate changeclimate change denialconspiracy theoriescritical race theorydemocratic partyeconomic collapseedward lorenzgender identity politicsgeorge sorosjerome corsijoe bidenjudith butlerklaus schwab
00:39:07
27 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Putin's New Nuclear Threat, Biden Admin Underestimates the Houthis, More Fani Follies
#ukraine conflictukrainereligious conservatismbiden administrationdonald trumpeconomic collapsefani willishezbollahhouthisiranjanuary 6thjeff desantisjens stoltenbergjerome corsimiddle east warnatonuclear warpolitical corruptionputinrafael grossi
00:32:28
26 Feb
Mon
The Truth Centra...
Dr. Jerome Corsi
Spy Wars, Middle Class Malaise and Banks Dropping ESG
#war euro bondsvladimir putinukrainian intelligence officersciaclimate action 100dmitry medvedevdonald trumpeconomic declinefederal reserve policyjerome corsimaidan rebellionnewt gingrichnew york timesnuclear escalationreligious rhetoricstate departmentthetruthcentralcomtom lungoukraine conflict
00:31:34
23 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
The Declaration of North America, WHO Pandemic Treaty and the Medical Martial Law Plan
#yuval noah harariworld health organizationmyriad geneticsagenda 21bill gatesbureau of justiceconspiracy theoriescrispr cas9donald rumsfeldgenetic modificationglobal health governancehuman rights abusesjerome corsiklaus schwabmedical martial lawmrna vaccines
01:03:55
20 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Medvedev's Dire Warning; Public Education's Propaganda Mills
#world war iiiwoke ideologyukraineb61 12 nuclear warheadscook county decarcerationcriminal justicedmitry medvedeveducation reformgatestone institutegeopoliticsgeorge soroshamasjerome corsimaidan uprisingmedia censorshipnatonuclear warraf lakenheathreligious persecution
00:35:51
15 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
Biden's 'Big Green' Giveaway; Gaslighting Over Russian Nukes
#world economic forumukrainepresidential dementiaburismademocratic party corruptionfani willisgreat resethunter bideninflation reduction actirsisrael hamas warjerome corsijoe bidenmedicarenatonato expansionnoah harari
00:57:38
14 Feb
Wed
The Truth Centra...
Dr. Jerome Corsi
Mayorkas Impeached; Climate Reparations Craziness and the Diversity Training Disaster
#world economic forumtucker carlsontranshumanismalejandro mayorkasarchbishop viganobill gatescentral bank digital currencyclimate change denialdavid haskelldeep state conspiracydei trainingeconomic declineelon muskimmigration policyjerome corsijoe bidenreligious fundamentalismtom suozzi
00:48:50
13 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
The Biden Admin's Rage-Filled Border Feud; WHO's Power Grab Needs to Be Stopped
#xavier becerraworld health organizationvladimir putinalejandro mayorkasbill gatesclimate change conspiracydeep state theorydemocratic party crisiselon muskjerome corsijoe bidenneuralinkpresidential dementiarand paulreligious freedom lawfaresatanic templesusan ricetedrostranshumanism
00:51:46
12 Feb
Mon
The Truth Centra...
Dr. Jerome Corsi
How Biden Has Opened the Door to a Global War'; U.S. Household Debt Tops $17.5 Trillion
#world war iiiworld economic forumukrainechinaclimate changecultural criticismeconomic collapseforeign policygazahillary clintonhunter bideniranjake sullivanjerome corsijoe bidenmitch mcconnellnancy pelosipolitical corruptionrussia
00:41:29
06 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Don’t Fall for the Dems’ Growth Hoax; Another Lefty Meltdown Over Tucker Carlson
#vladimir putinukraine wartucker carlsonbarack obamaclimate changedeieconomic collapseelectric vehiclesgold investmentgreen new dealhenry kissingerjerome corsijoe bidenjohn kerrynato expansionneo marxismswiss america
00:43:16
02 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
How Much Closer Are We to War with Iran? CA, NY May Soon Lead a Wave of State Bankruptcies
#world economic forumukraine conflictsubstackbiden administrationcameron campanella iichristopher wrayclinton foundationcloudhubcloward piven strategygreen energy policyhillary clintoniran nuclear programisrael hamas warjanuary 6 insurrectionjerome corsijohn kerryjohn podestapinochek
00:37:39
31 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
National Hispanic Christian Leadership Conference (NHCLC) Brings Forth HablaConUnMD.com Spanish-Language Telemedicine
#woke ideologytrillotelemedicine accesscorstetdreamersgoogle cloud platformhabla con un mdhispanic healthcareimmigration policyjerome corsinational hispanic christian leadership conferencenhclcopen border policiesprophetic activismreligious libertyroberto albinosamuel rodriguez
00:58:48
30 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
WEF Overlords Want to Euthanize the West; Why Wokies Continue to Demonize Israel
#yuval noah harariworld economic forumtotalitarianismalejandro mayorkasbill gatesborder crisiscarlo viganoclimate change policyfalse flag operationsgatestone institutegeorge sorosgideon prinsgreat awakeninggreat resethamasjb schurkjerome corsiklaus schwab
00:46:55
29 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Is the U.S. Already Kind of at War with Iran?
#woke marxismtransgender rightstom cottonarmy of godborder securityeconomic collapsegold and silveriran conflictiran nuclear programjanuary 6thjerome corsijoe bidenlindsey grahammitch mcconnellnet zero policiespoynter institutethe truth central
00:32:50
25 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
Border Showdown: Texas vs DC; Political Showdown: Kari Lake vs. The Swamp
#world economic forumus immigration policytran tifaagenda 2030america for salebiden administrationchina economic crisisgender identity issuesglobalist conspiracy theoriesgovernment corruptionhouthi rebelsjeff dewittjerome corsikari lakenational guardtexas border crisis
00:40:32
23 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Disease X: The Globalists‘ New Weapon
#world health organizationworld economic forumunited airlinesbiden administrationblinkenchinese communist partydemocratic party criticismdisease xeconomic collapseglobalist conspiracyhamashenry kissingerhezbollahiranisrael hamas warjerome corsimarxist ideologynational security memorandum 200obama administrationthe truth central
00:33:47
17 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
How the World Health Organization Can Force a Global Lockdown - with Dr. Kat Lindley
#yuval noah harariworld health organizationworld economic forumbiden administrationbill gatescentral bank digital currenciesdonald trumpeconomic crisisglobalist agendagovernment surveillanceinternational health regulationsjake sullivanjerome corsimilitary industrial complexnikki haleypandemic treatytedros adhanom ghebreyesustucker carlsonvivek ramaswamy
01:03:02
16 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Trump Easily Takes Iowa; Cold Temps Spell Trouble for EVs
#world economic forumron desantispolitical polarizationclimate change denialdeidonald trumpeconomic collapseelection fraud claimselectric vehiclesesggold rushjerome corsijoe bidenjohn kerrymedia biasnew york timesnikki haley
00:40:07
15 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Lawfare Against Trump is Fizzling Out; NBC Admits 'Deep State' Exists
#world economic forumvictor davis hansonrisa nenealvin braggclaudine gaydeep state conspiracydiversity equity inclusiondonald trumpdonald trump legal caseseconomic crisisfannie willisiowa caucusesjack smithjerome corsijohns hopkinsletitia jamesmary mccordnathan wadepete buttigiegreligious fundamentalism
00:41:53
10 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
Bloated DEI Departments Jacking Up College Costs
#university of michigantruth centralneo marxismal bureji refugee campbiden administrationburismacritical race theorycultural maoismdei departmentseconomic declineelectric vehicle marketenvironmental movementesg initiativesgazahunter bidenhunter biden corruptionisrael hamas warisraeli defense forcesjerome corsi
00:48:28
09 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Archbishop Vigano Takes Down the Davos Agenda; Blinken Doubles Down on Two-State Solution
#world economic forumvictor davis hansontucker carlsonanthony blinkenbill gatescarlo maria viganocritical race theorycultural collapsedepopulation theoryenergy policygeorge sorosglobal conspiracyhamasiranjerome corsijoe bidenklaus schwabmiddle east conflictpope francis
00:44:07
08 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Are Mass Layoffs Coming? The Left's NEW climate buzz-term: 'Climate Shadow'
#truthcentralspotifysound of freedomabortion rightsamazonclimate changeeconomic collapseeconomic collapse blogempire wind 2equinorgallanthasbrohouthiisrael hamas warjerome corsimaerskneo marxismnikeroe v waderussia ukraine conflict
00:38:28
05 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
2024: The Year to Cancel Wokeness
#woke ideologyklaus schwabjerome corsibeast limousinebill ackmanbill gatescarlo maria viganòclaudine gaycritical theorydei programselectric vehicleselise stefanikglobal depopulationgold investmentharvard universityiranisrael hamas war
00:52:48
04 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
Will 2024 be a Rough Year for the Globalists?
#woke communitysoleimanis tombreligious nationalism14th amendmentbill clintonclimate change debateepstein fileseugene debsfrankfurt schoolglobal debt crisisgold rushhamasinterglacial warmingjerome corsijoe bidenmarianne williamsonpolitical censorship
00:50:34
03 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
Will 2024 be the Year of Trump?
#world war iiiworld economic forumtransgender policies2024 electionbill gatesclaudine gaydei initiativesdonald trumpeconomic collapseel niñohamasharvard universityhezbollahjerome corsijoe bidenneo marxismreligious prophecythe truth central
00:48:56
02 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Iran, Houthis Ramp Up Red Sea Threats; Student Loan Borrowers Stage Debt Strike
#us national debtukrainesam bankman friedbiden familyclimate change denialcultural maoismdepartment of justicegazahamashouthi rebelsiranisrael hamas warjerome corsineo marxismpolitical corruptionred searussiarussia ukraine conflict
00:38:28
22 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Dems Step Up Lawfare Against Trump; Look Who's Responsible for Most of the Carbon Emissions
#the truth centralseth richmatt gaetzblack lives matterblack votersclaudine gayconspiracy theoriescritical race theorydavid kopeliandonald trumpeconomic collapseepoch timesfrankfurt schoolgold rushhsbc investigationisrael hamas warjerome corsijulian assangemarketing of evilmark fisher
00:55:16
19 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
The Pentagon: A Multi-Trillion Dollar Financial Fraud?
#thetruthcentralpentagonnuclear energy policyben carsonbenjamin netanyahubiden administrationclimate change debateclinton foundationcop28department of energygazagovernment corruptionhamashouthi rebelshunter bideniranisrael hamas warjerome corsineo marxismnet zero
00:50:44
18 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Inside the Projected $97 Billion in Global Debt; The US Ukraine Aid-Border Showdown Continues
#ukraine wartruth centralneo marxism97 trillion debtbiden administrationclimate changeclinton foundationcop28critical race theorydemographic declinedepopulation plangaza conflictglobal debt crisishamashenry kissingerjerome corsi
00:47:00
11 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
More Good News for Trump; An EU Showdown Over Ukraine Looms
#world economic forumviktor orbanukraine conflictblack lives mattercovid 20critical race theorydepartment of justicedonald trumpdonald trump legal challengesgazaglobal health securityhamasharvard universityhenry kissingeribrahim x kendiisrael hamas warjerome corsijoe bidenneo marxism
00:41:59
08 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
A Bad Week for the Bidens: Impeachment Inquiry for Joe, New Charges for Hunter
#world economic forumunited nationsthe truth centralbiden administrationclimate change denialgazahamashunter bidenhunter biden scandalinflation reduction actiranisrael hamas warjerome corsijoe bidenjoe biden impeachmentjohn kerrymuslim brotherhoodneo marxist conspiracy
00:46:14
06 Dec
Wed
The Truth Centra...
Dr. Jerome Corsi
Biden-Touted E-Bus Company Goes Bust; Is the EU Slowly Admitting the Truth About the Ukraine War?
#zelenskyukraine conflictthetruthcentralbiden administrationclimate policyeconomic collapsegeorge soroshillary clintonisrael hamas warjerome corsijohn kerrykhan younisnato expansionoctober 7th attackproterraqatarsolyndrasultan al jabbar
00:24:46
05 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
The Net Zero Emissions Agenda is Spiraling
#walking liberty half dollarrishi sunaknet zero tracker15 degree celsiusbritish parliamentclimate policyenergy transitionfinancial marketsgazageopoliticsglobal economicshamasinflation reduction actjerome corsimoodys
00:21:05
04 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Hamas and UN as Propaganda Partners; Gold Hits Record High
#unrwa accusationsunrwathe truth centralbiden administrationcarbon 60climate change debatecop28economic collapsegaza citygold marketgold pricehamasiranian influenceisrael hamas warjerome corsijohn kerrymichelle obamamunich olympics massacremy vital coctober 7th attacks
00:35:37
30 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Khrushchev's Secret Speech - 1956
#woke culturethe truth about neo marxismsecret speechantifaantonio gramsciblack book of communismblack lives mattercommunist historycultural maoismcultural revolutiongovernment controlimaginejerome corsijohn lennonjoseph stalinmao zedongneo marxismnikita khrushchevrobert gallatioli
00:40:03
29 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Did Deutsche Bank Just Destroy Letitia James’ Case Against Donald Trump?
#world economic forumseth richscott gallowayagenda 2030ari joffeclimate change skepticismdeutsche bankdonald trumpeconomic crisisfinancial fraudglobalist controlgovernment cover upsjerome corsijoe bidenjulian assangeletitia jamesrobert f kennedy jr
00:54:26
28 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Is NATO Deliberately Trying to Provoke Russia?
#world war iiithe truth centralrussiabaltic seabill clintonclimate change denialclinton foundationcultural warseconomic collapseglobal crashhillary clintonjerome corsijohn f kennedylyndon johnsonmilitary industrial complexnatonato expansionobama administrationrobert f kennedy jr
00:43:58
22 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Behind the Israel-Hamas Hostage Agreement; Is NATO Still Relevant?
#world economic forumtranshumanismstagflation50 hostagesbill gatescia conspiracyclimate change denialdavid manticeconomic collapsegerman constitutional courtiran nuclear dealisrael hamas warjerome corsijfk assassinationmaoist cultural revolutionnato obsolescencerichard lindzen
00:41:25
21 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Americans Raiding 401ks to Pay Rent and Mortgage; Elon Musk Takes On Far-Left Media Matters
#ukraine russia warthe truth centralsoft landing2008 subprime crisis401kbidenomicsclinton foundationcredit card debteconomic crisiselon muskfidelitygeorge soroshezbollahhillary clintoninflationisrael hamas warjerome corsimedia censorshipmedia mattersneo marxismpolitical corruption
00:44:49
20 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Argentina Elects Anti-Woke Milei as President; Israel Moves into Tougher Phase of War in Gaza
#woke agendaukrainepolitical polarizationargentinabiden administrationclimate change policycommercial real estate crisisdepopulation movementgazaglobal economic crisishamasiranisrael hamas warjavier mileijerome corsijohn kerrymedia bias
00:38:15
16 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Walter Duranty: Stalin’s PR Agent for the New York Times
#walter durantyukrainian faminestalinaleister crowleyclimate change denialcultural maoismgareth jonesjerome corsikamala harrismalcolm muggeridgemedia censorshipneo marxismnew york timespope carlo viganopostmodern culturesatanism
00:36:53
13 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
New Fighting by Israel's Northern Border; 'Scientists' Claim Hottest 12 Months in 125,000 Years
#zelenskyworld war iwoke culture1973 oil embargoamerican politicsbiden administrationchina green energyclimate change skepticismelizabeth warrenglobal economic crisishamashezbollahiranian revolutionary guard corpsisrael hamas warjerome corsijimmy carterkamala harrisploukraine conflict
00:40:11
10 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Israel Tries to Root Out Hamas Amid More Calls for Cease-Fire; Time to Pull the Plug on Forced EVs
#weworkneo marxismmosulchinese technologycultural revolutiondean heskineconomic collapseeuropean unionfordfree market economicsftxgaza citygmgreen energy mandateshamasisisisrael hamas warjerome corsimario draghi
00:54:51
09 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
U.S. Debt INTREST Now Over $1 TRILLION; U.S. Launches Air Strike on Iranian Group in Syria
#us national debtswiss american tradingsilverbank failureschase bankde bankingfdicfinancial privacyjamie dimonjerome corsinational debtncrfphysical goldprecious metalsrichard cromwellsac city bank
00:28:49
08 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Deleuze, Guattari, Butler: False Realities, Gender Theory and Today’s ‘Woke’ Identity Politics
#woke movementwhite privilegeto kill a mockingbirdanti oedipusbiblical interventioncatherine prendergastcultural maoismfélix guattarigender identitygender troublegilles deleuzegreat awakening trilogyjerome corsijudith butlerneo marxismpedophiliapostmodernismqueer theory
00:40:29
07 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Trump, Judge Clash During Trial in NYC; Netanyahu Says Israel Will Control Gaza
#weworkukraine conflictthetruthcentralcomcommercial real estate crisiscultural maoismdemocratic partydonald trump legal challengesgog and magoggold investmentgreen new dealiranisrael hamas warjerome corsijustice departmentneo marxismnetanyahuoctober 7th attacksrussia
00:43:09
06 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Israel Airstrikes Hit 450 Gaza Targets; A Brutal Week for the Green Agenda
#world war iiivolodymyr zelenskyukraine fatiguebiden administrationdinesh dsouzaeconomic collapseel niñogreen energy transitionhamashezbollahisrael hamas warjerome corsijohn kerryneo marxismoffshore windthe police statetime magazineukraine conflict
00:40:54
03 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Wagner Group to Aid Hezbollah; Globalists Are Claiming Climate Change is a "Global Health Crisis"
#zaluznyyanukovychworld health organizationclimate change conspiracydonald trumpelaine chaogeorge sorosglobal economic crashhezbollahhillary clintonjerome corsimaidan rebellionmitch mcconnellrussia iran alliancetreasury debtukraine war stalemateus political corruptionwagner group
00:36:23
02 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Israel's New Calculus: Strike Hamas at All Costs; Putin Defies Nuclear Test Ban Treaty
#political corruptionpinchuknuclear test ban treaty2 chronicles 7 14burismaclimate change denialconnecticut judgeend times prophecygazaglobal economic collapsehamashillary clintonhunter bideniraniranian influenceisrael hamas warjerome corsijohn kerrymaidan rebellionnamazi
00:45:36
01 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
How the Left is Falling Apart Over Israel and Hamas; Why a China Crash is Coming
#world war iiius foreign policythe coming global crash will create an historic gold rushanti defamation leagueblack lives matterchina real estate marketcultural marxismeconomic collapseelectric vehiclesgold investinghezbollahhyperinflationirs offsetsisrael hamas warjerome corsimike johnsonoffshore wind
00:47:33
31 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Israel's Counterattack Continues; U.S. to Borrow $1.5 Trillion More Debt in Q4
#world war iiipolitical corruptionnational debt2 chronicles 7 14astrazenecabric nationsclimate change hoaxdemocratic partygold rushhamashillary clintonhunter bidenipcciranisrael gaza warjerome corsimodern monetary theory
00:45:30
30 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Big Bond Bear Market Could Be On the Way; Israel Makes its Move in Gaza
#woke culturepolitical corruptionoctober 7th attacks2008 subprime crisisbear marketclimate change hysteriaelectric vehicle mandatesgaza wargeorge sorosglobal economic crisisgold investmenthezbollahhunter bidenisrael hamas warjerome corsimortgage market collapsemortgage sectornational debtneo marxist agendaoctober 30 2023
00:39:57
27 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Max Horkheimer, Theodore Adorno and Neo-Marxist Theory - Where Woke Came From and Where it's Going Pt 6
#woke ideologyvtruthcentraltransgender issuescultural industrycultural maoismdialectics of enlightenmentfeminismfrankfurt schoolidentity politicsimmanuel kantjerome corsijuliettekarl marxmarquis de sademax horkheimerreligious repentancetheodor adorno
00:35:55
26 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Herbert Marcuse: The Father of the New Left - Where Woke Came From and Where It's Going Pt 5
#woke insanityvietnam warthe truth about neo marxismabbie hoffmana critique of pure toleranceangela davisbill gatescritical race theorycultural maoismeros and civilizationfrankfurt schoolglobalist conspiracyherbert marcuseidentity politicsjerome corsijohn f kennedyjohn rawlsjürgen habermasklaus schwabneo marxismnew leftone dimensional manrepressive tolerancetheodore allen
00:44:59
25 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Howard Zinn's Fake History: Where Woke Came From and Where it's Going Part 4
#woke culturethomas jeffersonsidney powellanarchycultural maoismdeep truth centraleconomic collapseglobal crashgold rushhillary clintonhistoric gold rushhoward zinnjenna ellisjerome corsineo marxismpostmodernismsaul alinsky
00:41:32
24 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Where Woke Came From and Where it's Going: Hegel and Marx -- Part 3 in a Series
#world economic forumtsar nicholas iitranshumanismantonio gramscicultural maoismdepopulation movementseconomic collapsefederal reserveglobalist new world ordergreat awakening trilogyidentity politicsjerome corsikarl marxleninneo marxismsean mckeeganthe truth about neo marxism
00:28:10
23 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
The Neo-Marxist Foundations of Today's Woke Culture
#woke culturewilliam z fosterweather undergroundbarack obamabella doddbill ayerscommunist infiltrationeconomic collapsefrank marshall davishouse un american activities committeejack kawanojerome corsikarl marxmedia censorshipneo marxismthe truth about neo marxism
00:37:49
20 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Rocket Attacks on Israel Could Lead to a Full Regional Conflict
#world economic forumsocial credit systemspresident bidencbdceconomic collapse predictionsgaza cityglobalist conspiracy theoriesgold pricesgovernment corruption allegationshamasiraniran regional conflictisrael hamas warjerome corsijoe mccorskeyjulian assangeklaus schwabmueller investigation
00:38:16
19 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Are We Headed for a New World War?
#world economic forumunited nationsukraine warbiden administrationclimate change hoaxclinton foundationglobal economic crashgold rushgreat resethamashsbciranjerome corsimichael mannmiddle east conflictnatoneo marxists
00:42:58
18 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Bidenvilles; The New Hoovervilles; Inside the Explosion at Al-Ahli Hospital in Gaza
#world war threerobert f kennedy jrreligious judgment2 chronicles 7 14al ahli hospitalbidenvilleseconomic collapsegaza conflictgold rushhamashezbollahiranisrael hamas warjerome corsijoe bidenoctober 7th attackspolitical extremism
00:45:10
16 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
FBI Warns of Hamas Attacks on US Soil; Housing Market to Further Sink
#world war iiiuaw strikethe truth centralbiblical prophecybiden administrationcommercial real estateeconomic recessiongold priceshamashezbollahisrael hamas warjerome corsimagogneo marxist policiespolitical impeachmentrobert hur
00:42:28
13 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Will the Dems Push Michelle Obama as their 2024 Prez Nominee? Joel Gilbert joins Dr. Jerome Corsi
#weather undergroundthe truth centralsouth carolina primarybarack obamabernadine dorncabrini greenchicago conventiondemocratic partyfrank marshall davisisrael hamas warjerome corsijoel gilbertmichelle obamamichelle obama 2024political conspiraciesracial discriminationrichard daley
00:41:55
12 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Inside the Israel-Hamas Conflict and What the Abraham Accords Missed
#yom kippur warworld war iiiwoke neo marxismabraham accordsantifablmciacommercial real estateezekiel 37 38federal reserveglobal economic crashgold market speculationhsbcisrael hamas warjerome corsimiddle east geopoliticsopec embargo
00:45:30
11 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Israel: Facing War from Multiple Sides
#us foreign policythetruthcentralreligious interpretationatomic iranclinton foundationconspiracy theorieshamashezbollahiraniran nuclear programisrael hamas conflictisrael hamas warjake sullivanjerome corsijoe bidenjoel mccorseyjohn kerry
00:32:12
10 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Israel vs. Hamas: The Truth and What's Next?
#yom kippur warworld war iiiopen bordersbiden administrationclimate change activismgazahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsineo marxism
00:50:55
09 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Iran Helped Hamas Plan Attack on Israel; Why Oil Could Hit $150 per Barrel
#obama administrationnew world orderneo marxismbiblical prophecybiden administrationclimate change skepticismcloward piven strategycommercial real estate bubbleeconomic crisisepahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsimilitary industrial complex
00:42:53
06 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Biden to Build More of Trump's Border Wall; The Race to be the Next House Speaker
#the truth centralpioneer natural resourcesjim jordanamerican politicsbiden administrationclimate change debatedemocratic partydonald trumpexxonglobal economicsgramscigreen energygreen energy policygreen murderian plimerimmigration policyjerome corsi
00:41:26
05 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
FBI Targeting Trump Supporters Ahead of 2024 Election; OPEC Says Oil Could Hit $100 per Barrel
#un net zero banking allianceunited auto workersukraine warbiden administrationclimate change denialcultural maoismeconomic collapseeducation reformenergy securityepa mandatesesg policiesfbigeneral motorsgovernment surveillancejerome corsilabor unionslatin massnato expansionopecthetruthcentral
00:35:24
04 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Scientism, De-Populationists & the Climate Cult
#zbigniew brzezinskitranshumanismthe first global revolutionclimate change denialclimategateclub of romeecosciencegeorge sorosgreat resethenry kissingerjean baudrillardjerome corsijohn holdrenjürgen habermasmichael mannone world governmentpaul ehrlichpopulation controlpostmodernism
00:41:28
02 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Will McCarthy be Ousted as Speaker? How the Global Elite Created "Climate Change" to Establish a New World Order
#russia sanctionsrobert kennedy jroperation mockingbirdbill gateschina real estateclimate changeclub of romecultural maoismdepopulation agendaespionage actgeorge sorosglobal economic crashhenry kissingerjerome corsikevin mccarthykissinger reportmatt gaetzneo marxism
00:41:24
29 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Biden Impeachment Hearing Bombshell: The Inevitable EV Implosion
#world war iiiukraine aidoleg kolomoiskybiblical principlesburismacommercial real estatedepartment of justiceelectric vehicle mandatesgovernment shutdownhouse oversight committeeimpeachment hearingsjames comerjerome corsijoe bidenkamala harrismass immigrationmichelle obamaneo marxism
00:44:36
28 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
Countdown to a Shutdown? New Memos Spark More Biden Corruption Charges
#wuhan labswoke neo marxist agendasurveillance stateanthony faucibiden familyburismaciaclinton foundationcovid 19 originsentitlement spendingforeign agents registration actforeign corruptiongain of function researchglobal credit crisisgovernment shutdownhillary clintonjerome corsijim jordanmatt gaetzmilitary industrial complex
00:28:56
27 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Why We're Not Ready for an Economic Worst-Case Scenario; Why Bill Gates is Running From the Climate Doom Narrative
#the truth centralswiss americasars cov 2anthony faucibill gatesclimate change hoaxeconomic inflationgovernment corruptionhunter bidenjamie dimonjerome corsijoe bidenmodern monetary theorypanasonic evphiladelphia lootingpublic health conspiracyreligious repentance
00:43:07
25 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
Is mRNA Vaccine-Laced Meat Coming Soon? Oil to Hit $100?
#us national debtthetruthcentralcomrussia ukraine war2024 presidential electionbob menendezconstitutional principlesdonald trumpeconomic stagflationespionage act of 1917federal reservegeorge soroshillary clintonhunter bidenjerome corsimichelle obamamrna vaccinesnato expansionnet zero climate policies
00:39:03
22 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Marxism's Dark History: Starvation as a Political Weapon
#woke culturetotalitarianismthetruthcentralcombella doddcritical theorydialectic of enlightenmentfrankfurt schoolgreat leap forwardgustavo gutiérrezherbert marcuseholodomorjerome corsiliberation theologymao zedongneo marxismstalinsustainable development goals
00:45:49
21 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
Poland to Stop Arming Ukraine; Big Q4 GDP Downturn Coming
#uaw strikesthe truth centraltaiwan invasionchina military drillsclimate change policyclinton foundationeconomic recessionelectric vehicleselectrification debatefederal reservefederal reserve policygeopolitical conflictjerome corsikevin mccarthynancy pelosirobert kennedy jr
00:41:24
20 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Leaked: A Plan to Oust McCarthy; Blue Mayor's Eco-Totalitarian Overreach
#world bankshadowstatsmichelle obamaclimate change denialcovid 19david kopelianeconomic inflationfdagold investmentgovernment shutdownivermectinjanet yellenjerome corsijoe bidenkate gallegokevin mccarthymarxist agendamatt gaetz
00:44:13
18 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
The CCP's New Bio-Weapon Plan; The EV Honeymoon is Over
#world economic forumshadow statsopecamerican library associationbill gatesbricsclimate change denialcultural marxismdow joneseconomic collapseenergy transitionfreedom caucusglobal health crisisgovernment shutdownjerome corsikevin mccarthyklaus schwabmarjorie taylor greenematt gaetznational security directive 200
00:42:49
15 Sep
Fri
The Truth Centra...
Dr. Jerome Corsi
Hunter Biden Indicted; How Bidenomics is Destroying Our Economy
#yuval noah harariyoutube shadowbanningthe truth centralarchbishop viganobidenomicsbricseconomic collapsegeopolitical conflicthunter bidenhunter biden indictmentinternational energy agencyjerome corsijoe bidenjoe biden impeachmentkamala harrismedia censorshipreligious freedomrumble
00:43:03
14 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
The Dirty Secret About How Masks Really "Work" and Marching Orders to Media Are in Over Biden Impeachment Plan
#ukraine russia conflicttruth centralsmart metersbarack obamaeducation reformgovernment surveillancehenry kissingerhunter bidenhydroxychloroquineinternational conflictivermectinjerome corsijoe bidenmrna vaccinesnational security memorandum 200political corruptionpublic health policy
00:43:38
13 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Biden Impeachment Plans Are a Go; China Using AI to Spread Disinformation
#zelenskyworld economic forumwashington post9 11biden administrationbricsbrics allianceconspiracy theorieseconomic declinehunter bidenimpeachment hearingsjerome corsijfk assassinationjoe bidenkamala harrisnew york timesopecukraine war
00:38:45
12 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
Biden to Send $6B to Iran; An "Emergency Approval" For the New COVID Vax
#zelenskyukraine warukraine counteroffensivebiden administrationbricsbrics expansionclimate change denialclimate hoaxcovid 19 vaccineseconomic collapseeg5 variantfdafifth circuit courtgold pricesgreen heating lawhunter bideniraniran nuclear dealisraelivermectinjerome corsi
00:36:36
07 Sep
Thu
The Truth Centra...
Dr. Jerome Corsi
US Sinking Another $1B Into Ukraine War Disaster; EV Hoax Exposed
#zelenskyworld economic forumwoke culturecovid 19 conspiracydonbasseconomic declineelectric vehiclesfoundation for individual rights in expressionfree speechgreat resetharvard universityjerome corsijoe bidenjohn kerrynatothe truth centralukraineukraine warvladimir putin
00:42:34
31 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
Get Ready for a Recession, Stagflation; BRICS Poised to Control Global Energy Supply, Currency
#woke ideologywarren buffetttranshumanismal gorebricsciaconspiracy theoriescultural wareconomic recessionfederal reservegeopoliticshousing marketinflationjerome corsimichael burrymodern monetary theorysaudi arabiathe truth central
00:40:01
30 Aug
Wed
The Truth Centra...
Dr. Jerome Corsi
National Archives Reveals Biden Used Fake Names to Email Sensitive Info to Hunter; A Plan to Un-Bloat the Federal Government
#project 2025national archivesmedia biasassociated pressbiden emailsclimate change denialdepartment of justicedonald trumpelection fraudgreen murderheritage foundationhunter bidenian plimerjerome corsijohn clauser
00:37:24
28 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Will House Republicans Really Impeach Biden? Top Law Schools Propose Ditching the Constitution
#yaleviktor shokinukraine aid1619 projectclimate changecritical race theorydevin archerdonald trumpharvardhunter bidenimpeachmentjerome corsijoe bidenjohn kerrymodern monetary theoryneo marxismstanfordtotalitarianism
00:37:30
25 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
Trump's Historic Mugshot; The Left's New Scam-Demic COVID Narrative Strategy
#will happerrichard lindzenmail in ballotsanthony faucibricsbrics allianceclimate change denialcovid 19donald trumpelection interferencefederal reserveglobal coolinggold standardhunter bidenjerome corsilawfaremaidan rebellion
00:44:04
24 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
Republican Primary Debate Analysis; Will New EPA Regulations Starve Millions?
#yevgeny prigozhinwill happerwagner groupbret baierchris christiechris wallaceclimate change denialdonald trumpeconomic collapseepa regulationsgeorge sorosgovernment distrustjerome corsimike penceneo marxismreince priebusrepublican debaterichard lindzenron desantisrussia ukraine war
00:40:01
23 Aug
Wed
The Truth Centra...
Dr. Jerome Corsi
Is Global De-Dollarization Irreversible? Why the Lawfare Against Trump is Unconstitutional
#vladimir putinukraine wartonga volcanic eruption14th amendmentbretton woodsbrics nationsclimate change denialdollar de dollarizationdonald trumpdonald trump legal challengeshillary clintonjerome corsijoe bidenlula da silvamaui wildfiresreligious valuesswiss americathetruthcentralcom
00:38:37
22 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
Will Car Prices Become Unsustainable for Buyers? Why the Ukraine War Must End
#whounukraine waragenda 2030colonel mcgregorconspiracy theoriesdonald trumpeconomic collapseelectric vehiclesgeorge soroshillary clintonhunter bidenjerome corsimaidan rebellionmedia censorshipmilitary intervention
00:42:17
21 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
U.S. Banks Take $18.9B in Losses; Are "Climate Emergency" Lockdowns Coming?
#world economic forumpolitical polarizationneo marxism401ksbiden administrationbill gatesbricscommercial real estateconspiracy theoriescritical race theorydonald trumpeconomic collapseerisevergrandefinancial crisisglobal governancejerome corsi
00:40:08
18 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
Has Putin Already Achieved His Goals in Ukraine? Will Michelle Obama Run in 2024?
#zhongnong international trustwestchester countyvladimir putin2024 electionaffirmative actionalexander lukashenkocountry garden holdingsdemocratic party strategydonald trumpf 16housing market crashhud rulejerome corsijoe manchinmichelle obamanatoneo marxismno labels partysan francisco housingstudent loan debtted cruzukraine warus student loans
00:35:52
17 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
Another Way Lawfare vs. Trump Could Backfire: San Francisco's Downward Spiral Continues
#ukraine warsocial unrestsan franciscoandy harrisantifaantony blinkenbricsdonald trumpeconomic collapsegeorge soroshillary clintonjake sullivanjerome corsikarl poppernato expansionpolitical corruptionrinat akhmetov
00:37:04
15 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
Scientists: EPA Regulations Based on a Hoax; School Attendance Plummets Nationwide
#will happertucker carlsontonga volcanoclimate change denialconspiracy theoriescritical race theorydonald trumpeducation reformelection integrityel niñoepa regulationsjerome corsipolitical polarizationrichard lindzenrobert kennedy jrrudy giulianisidney powell
00:43:48
14 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Why the Ukrainian Counteroffensive is Failing; Will Parts of the US Become Ungovernable?
#westfield topanga mallweaponized dollarultra low emission zonebiden administrationbricsclimate change denialcritical race theoryeconomic collapsegovernment conspiracy theoriesjerome corsinational security study memorandum 200nordstrom storereligious revivaltruth centralukraine counteroffensive
00:38:02
10 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
Bank Records Show Biden Family Received Millions in Payouts from Russia, Ukraine & Kazakhstan
#yelena baturinathetruthcentralstock market crashbiden foreign paymentscbdcchristopher wrayclimate change conspiracydevin archerfbi religious persecutionhunter bidenhunter biden corruptionjerome corsijoe bidenlatin massneo marxistsrosemont seneca thornton
00:37:42
08 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
How Trump's Indictments Could Backfire on Biden; The Real Threats to America
#walking liberty half dollarvictor davis hansonthetruthcentralcom2020 election fraud claimsamy jackson bermanclimate change denialdepartment of justice corruptiondevlin archerdonald trumpeconomic recessionespionage acteugene debsfirst amendment rightsfitch ratingshunter bidenjerome corsijoe bidenjudge eileen cannonpost modernism critique
00:25:23
07 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Pence's Testimony Could Prove Trump's Innocence in Jan 6th Case; Bidenomics Leads to Lower US Credit Rating
#us credit ratingthe truth centralroe v wadeclimate change conspiracydepartment of justicedonald trump legal challengeseconomic recessionfitch ratingsgeorge w bushhunter bidenjanuary 6thjerome corsikissinger reportmike pencenssm 200paris agreementpolitical bias
00:37:33
04 Aug
Fri
The Truth Centra...
Dr. Jerome Corsi
Marcuse's Utopia, Post-Modernism and Today's Left
#world economic forumtranshumanismthe truth centralclimate changeeros and civilizationfrankfurt schoolglobal warminggreat awakening trilogyherbert marcusejerome corsineo marxismone dimensional manpostmodernismrepressive tolerance
00:33:14
03 Aug
Thu
The Truth Centra...
Dr. Jerome Corsi
Jean Baudrillard, Post-Modernism, the Matrix and the Truth
#woke movementthe matrixsimulacrumclimate changecultural maoismfrankfurt schoolgodgulf war did not take placejean baudrillardjerome corsineo marxismobjective realitypostmodernism
00:37:36
01 Aug
Tue
The Truth Centra...
Dr. Jerome Corsi
Defending Your Money from a Potential Global Economic Crash - with Swiss America CEO Dean Heskin
#swiss americast louissan francisco2008 subprime collapsecbdccentral bank digital currenciescommercial real estatecommercial real estate bubbledean heskineconomic inflationfednowfinancial crisisgold investmentgold rushjerome corsijimmy cartermenu grocery products
00:43:04
31 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
NATO's Dance with Ukraine and Are We Headed Toward WW3 - with Tony Shaffer
#xrpworld war iiivladimir putinbudapest memorandumcentral bank digital currencyclimate change skepticismfederal reservefednowgeorge sorosglobalist conspiracyjake sullivanjerome corsinatonato expansionnew world ordertony shafferukraine
00:36:48
26 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
Crime in Dem-Run Cities Worse Than You Think; Media Runs Defense for Impeachment-Bound Biden
#political corruptionneo marxismjonathan turleyblack lives matterchrisciaconspiracy theoriescrime statisticsdeep statedemocratic partydevin archerelection integrityenergy policyhsbchunter bidenjerome corsijoe biden
00:34:20
25 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
The Destruction of the Middle Class; Biden Targets Your Water Heater
#robert f kennedy jrpolitical polarizationmedia censorshipbarack obamabiden administrationclimate change denialconspiracy theoriesdepartment of energydigital services actdonald trumpfisa courtsfrank marshall davisgovernment surveillancehillary clintonhunter bidenjerome corsijoe rogankathy hochul
00:34:31
20 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Exactly How Disastrous Have the Ukraine War and Influence-Peddling Allegations Been for Biden?
#us justice systemukraine warthe truth centralbiden family corruptionclimate change denialcointelprodemocratic party critiqueelectric vehicleshouse oversight committeehunter bidenjerome corsijudith curryjulian assangenavier stokes equationsneo nazi factionoperation crossfire hurricanesteele dossier
00:35:47
19 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
US Sends Fighter Jets to Gulf of Oman; BRICS Gold-Backed Currency Project Gains Speed
#us dollarukraine warswift sanctionsbiden administrationbricsbrics goldclimate change scienceclimate change skepticismdollar weaponizationf 16 jetsglobal financial crisisiran nuclear programisraeljerome corsiodessaponzi schemeraymond voyagersouth africastrait of hormuz
00:45:35
18 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
Climate Lockdowns Begin; Pentagon Finally Admits Failure as Ukraine Counter-Offensive Sputters
#zelenskyworld war iiiukraine warbiden administrationblackrockclimate policyeconomic collapseesg investingfbigovernment corruptionjerome corsilarry finknato expansionrobert f kennedy jrthe truth central
00:43:38
17 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
Globalists Publish Plan for Worldwide Financial ENSLAVEMENT Via a Unified Ledger
#zoltan pozarzelenskyukrainebricsbrics currencycbdccentral bank digital currenciesclimate change denialcommercial real estate crisisdaniel greenfielddonald trumpel niñojerome corsijoe bidennato expansionswiftswiss americatransgender rights
00:43:27
14 Jul
Fri
The Truth Centra...
Dr. Jerome Corsi
Marxists Declare 1st Amendment a "Psychological Disorder;" US Debt Interest Payments to Hit $1 TRILLION
#zelenskyxrp lawsuitxrpbitcoincentral bank digital currenciesclimate change debateco2 coalitiondemocratic party historyfbifederal debt crisisfederal reservefirst amendment rightsinformation disorder syndromejerome corsijohn clauserjohn kerryponzi schemeroe v wadesecukrainian spy agency
00:43:10
13 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Bidenomics Equals Stagflation; UN Sustainability Agenda: Destroy the Middle Class
#world economic forumstate farmstagflationallstatebiden administrationclimate changecommercial real estateconsumer price indexcultural maoismelectric vehiclesfarmers insuranceglobal governancegoldimfjerome corsijudith currynationwide mutual
00:43:04
10 Jul
Mon
The Truth Centra...
Dr. Jerome Corsi
Biden's Plan to Block Out the Sun; Mortgage Payments at Record High
#woke ideologyukraine warthetruthcentralbricschernobylclimate change solutionscommercial real estate crashde dollarizationdutch governmentfederal reservefrance riotsglobal economic collapsejerome corsinirmal kandelrussiashanghai cooperation organizationswiss americathe coming global crash
00:39:06
07 Jul
Fri
The Truth Centra...
Dr. Jerome Corsi
Americans Lost $1.76 TRILLION in Savings Since 2020; The Recession We Were Expecting is Already Here
#united states recessionthetruthcentralsocial media regulationaffirmative actionaffirmative action decisionasian americansbiden administrationcalifornia exoduscritical race theorycultural marxismeconomic collapsejerome corsinational debtneo marxistspersonal savings ratepolitical migrationsocial media censorship
00:40:11
05 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
Another Victory for Free Speech over Censorship; What Happens if the BRICS Launch a New Currency?
#xrpwalking liberty half dollarus dollarbiden administrationbricsbrics allianceclimate change denialde dollarizationeconomic collapsegold standardgovernment censorshipjerome corsilouisiana injunctionopecreligious freedomroe v wadeswift systemthe coming global crash
00:37:21
29 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
Chinese Saboteurs Coming to America; Identity Politics: The Gateway to Transhumanism
#world war iiiukraine wartruth centralantony blinkenbill gateschina threatcommercial real estateeconomic recessionesg investinggordon changgreen energyhunter bidenhunter biden laptopinverted yield curvejerome corsineo marxismtaiwantranshumanism
00:46:37
28 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
Iran Close to Testing First Nukes; EU Wants to Block Out the Sun
#the truth centralsvensmarksolyndrabiden administrationbill gatesbud lightchristensenclimate changecultural decaydonald trumpeconomic declinehamashunter bidenipccjerome corsilordstown motorspolitical corruptionsolar activity
00:40:08
27 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Woke Hollywood Going Broke; First-Time Unemployment Claims Highest Since Oct 2021
#woke ideologyturning redtotalitarianismalex pollackclimate change denialclimatismcritical race theorydonald trumpeconomic declineeuropean central bankford motor companygerman bundesbankindiana jones and the dial of destinyjerome corsijoe bidenjonathan cahnkohei saitolightyearlord of the rings the rings of powermarxism critiquematthias desmetmichael snydermike hulmepeter pan and wendysan franciscostrange worldthe little mermaid
00:43:52
26 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Biden's Catastrophic Failures, Macron's International Tax Plan and China's Failing Economy
#truth centralnato article 5milankovitch cyclesbiden administrationclimate change denialconspiracy theorieseconomic collapseesg investinghermeticahunter bidenjerome corsijohn kerryjonathan cahnklaus schwablondon breed
00:37:35
22 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
New Low Test Scores Expose State of US Education; The Housing Market is Dying
#transgender therapythe truth centralpuberty blockersblackrockclimate change denialcritical race theoryeconomic collapseeducation declineesg assetsfederal reservegeorge papadopouloshousing crisisjerome corsimifsudmilankovitch cyclesneo marxismnew york times
00:38:48
20 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Lawfare: The Leftists' Political War on Donald Trump; More Nations Turn to BRICS as De-Dollarization Continues
#ukraine conflictthe truth centralpope francisandrew weissmanbricsclimate changeconstitutional authorityde dollarizationdonald trumpeconomic collapseespionage actfederal reservejerome corsijohn kerrylarry tribelawfaremerrick garlandneo marxism
00:39:20
19 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Why Worldwide Inflation Is Not Going Away; The Global Food Shortage Gets Worse
#world economic forumworld central bankwar in ukraineclimate change policyconspiracy theorieseconomic collapseeducational reformfederal reservefiat money printinggain of function researchgeorge sorosglobal food shortagegold and silverhillary clintonhoward zinninflation crisisjerome corsimaidan rebellionmilankovitch cyclessan francisco
00:41:30
16 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
The Decline of Affordable Housing; More Danger for Regional Banks - The Truth Central
#world economic forumtiny housesthe truth centralbill gatescommercial real estate crisiscommercial real estate loansdean heskindonald trumpespionage actfederal reserve policygold market speculationgold rushhousing affordabilityjerome corsipolitical censorshipregional banksstudent loan debtstudent loan repayment pause
00:41:43
14 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
The Trump Indictment: Weak and Embarrassing - A Deep Dive into the "Charges"
#world economic forumpresidential records actpresidential indictmentamy berman jacksonbiden administrationbill clintonclimate changecultural marxismdonald trumpespionage actespionage act of 1917hillary clintoniranisrael nuclear weaponsjerome corsijohn kerrykohei saitomatt gaetznational debtnewsmax
00:43:15
13 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
Burisma Owner Says He Has Proof of Biden Taking Bribes; Is the EU Covering Up a Scandal of its Own?
#william barrwestfield groupviktor yanukovychchristopher wrayclimate change policycommercial mortgage backed securitiescommercial real estateconspiracy theorieseconomic collapseeva kailigeorge soroshunter bidenjerome corsijoe bidenklaus schwabkohei saitolinear no threshold modelpolitical corruptionthetruthcentral
00:42:25
12 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Trump Polls Up After Indictment; Are Canadian Wildfires a Result of Eco-Terrorism?
#urban crisisukrainian briberysan franciscoclimate change denialcolumbia business schoolcultural marxismdonald trumpeconomic declinehandmheartland institutejerome corsijoe bidennew york citynoaanordstromnyu stern business schoolpolitical persecution
00:40:59
07 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
Tucker's Triumphant Return; US Debt Spikes After Ceiling Agreement
#tucker carlsonthe truth centralsackett v epa2008 financial crisiscommercial real estateeconomic collapseenvironmental regulationfbi corruptionfederal reserve policygold priceshillary clintonhilton hotelsjerome corsikakhovka dammueller investigationpark 55political corruption
00:42:41
06 Jun
Tue
The Truth Centra...
Dr. Jerome Corsi
WHO Already Prepping for Next Health Crisis; More Proof Lockdowns Were Failures
#world health organizationwalter durantyukraineclimate changeendotoxinsgeopoliticsgold rushinstitute of economic affairsjerome corsilab grown meatneo marxismnew york timesnuclear warpandemic policyrussiastalinthe truth central
00:38:46
05 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
AI's Extinction Risk; Ireland May Kill 200,000 Cows to Please Climate Activists
#world economic forumpolitical persecutionplandemic 3artificial intelligencebricsclimate changeconspiracy theoriesdepartment of justicedonald trumpdr zelenkofast and furiousfbiglobal nuclear warjerome corsijoe bidenjohn kerryklaus schwab
00:33:42
31 May
Wed
The Truth Centra...
Dr. Jerome Corsi
The Tide Turns Against Climate Change Fanatics; Debt Ceiling Agreement Orders Student Loan Payments to Resume
#zerohedgeukraine warstudent loansantarctic doomsday glacierbiden administrationclimate changedean heskindebt ceilingepoch timesgeopoliticshans mohnkehillary clintoninflationjerome corsistudent loan forgiveness
00:36:28
30 May
Tue
The Truth Centra...
Dr. Jerome Corsi
More Store Closings Loom, Economic Impact of El Nino and The Ukraine War Heading into the Endgame
#zelensky governmentukraine warubs reportbriccarbon dioxideclimate change denialcultural wardefund the policedepartment of justiceeconomic collapseel niñogeopolitical conflicthillary clintoniranisraeljerome corsijulian assangepolitical persecutionroger stone
00:35:53
26 May
Fri
The Truth Centra...
Dr. Jerome Corsi
How and Why U.S. Cities Are Destroying Themselves; America Losing Influence in the Middle East
#the coming global crash will create a historic gold rushsan francisco graffitiopen society foundationaction center on race and economybrandon johnsonbricscommercial real estate crisiscultural maoismdebt ceiling agreementezekielfirst we get the moneygeorge sorosglobal economic collapsegold price predictionjerome corsimahdimiddle east geopoliticsnuclear weapons proliferation
00:39:42
24 May
Wed
The Truth Centra...
Dr. Jerome Corsi
Ukraine Can Not Win; Yellen Warns Over Debt Ceiling; Inflation Woes Continue
#viktor pinchukviktor orbánukraine warcarbon 60climate change denialdebt ceiling crisiseconomic distressenergy securityfederal reservejanet yellenjerome corsijulian assangemueller investigationmy vital cnorway oil explorationoffshore wind farmspodesta emailsstagflation fears
00:37:10
23 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Are More Bank Failures and a Housing Bust on the Way?
#woke culturewater vaporukraine warbakhmutcarbon dioxideclimate changeeconomic crisisfederal reservegeopolitical conflicthouston developerjamie dimonjerome corsipapo cate petipolitical polarizationsilicon valley banksolar irradiancetim scott
00:36:11
22 May
Mon
The Truth Centra...
Dr. Jerome Corsi
Pushing Back vs the WHO Global Governance Power Grab; Bakhmut Falls
#zambiaworld health organizationwagner groupbakhmutbelt and road initiativechina us relationsclimate change policyexxonfinland nuclear powerglobal debt crisishillary clintonjerome corsikenyamarxism critiquemichelle obamapakistanrinat akhmetovrussia ukraine warsri lanka
00:35:48
19 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Ukraine Preps Allies for Disappointment; Debt, Inflation Burying U.S. Middle Class
#world war threewoke cultureukraine warbricschinachina ambitionsclimate changecryptocurrency regulationdurham reporteconomic inflationglobal escalationgold and silveriranjerome corsimicaneo marxismpresident bidenrussia
00:31:37
18 May
Thu
The Truth Centra...
Dr. Jerome Corsi
US Power Grid at Elevated Risk; Credit Card Debt Close to $1 Trillion
#zola levitt ministrieswind energysolar energycloward piven strategydebt ceilingdrug usedurham reporteconomic crisisfbigeopolitical conflictinternational renewable energy agencyjerome corsimarijuanamedicarenercnuclear powerpolitical corruptionrenewable energysocial security
00:33:15
17 May
Wed
The Truth Centra...
Dr. Jerome Corsi
Why Climate Change Zealots Ignore Clean Nuclear Energy
#vladimir yanukovychukraine conflictrobert oppenheimeranti capitalismantonio gramscicarbon dioxideclimate changecultural marxismelectric vehicleseuropean unionfrankfurt schooljerome corsijohn kerrymaidan revolutionnitrous oxidenuclear energyoliver stonepresident zelensky
00:33:01
16 May
Tue
The Truth Centra...
Dr. Jerome Corsi
The Durham Report Confirms What We All Knew with LTC Tony Shaffer
#western interferencevictoria nulandukrainebarack obamaclimate change denialdonald trumpdurham reportfbigeorge soroshillary clintonjerome corsijoe bidenmilankovitch cyclesnatonato expansionproject sentinelrussiarussia ukraine wartony schaffer
00:31:58
15 May
Mon
The Truth Centra...
Dr. Jerome Corsi
Will Biden Administration Foreign Policy Lead Us Into WWIII?
#volodymyr zelenskyunemployment benefitsukraine warclimate change denialcredit card debtdemocratic primaryeconomic recessiongates institutegerman arms packagehillary clintonipcciran nuclear programjerome corsijoe bidennatoneo marxistrobert f kennedy jrrussiathe truth central
00:38:13
12 May
Fri
The Truth Centra...
Dr. Jerome Corsi
The Global Food Supply is At Risk; Chaos After Title 42 Expires
#will happerukraine conflictukraineclimate change skepticismcloward piven strategyfood supply securitygreen movementimmigration policyjerome corsimacmillan agencymaidan revolutionmarxist agendanitrogen fertilizerrichard lindzenrussian oligarch assetsswiss americathe truth centraltitle 42
00:37:18
09 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Reparations, Fiat Currency, Wind Turbines, EVs: The Math Does Not Add Up
#swiss americasaudi arabiaobamaaleksandr solzhenitsynbarbara leebidenbricscalifornia reparationsclimate changecritical theoryeconomic collapseelectric vehiclesepagovernor newsomhillary clintoniranjerome corsimatt mcmillanmockingbird project
00:34:39
08 May
Mon
The Truth Centra...
Dr. Jerome Corsi
Thousands of US Banks are Potentially Insolvent; California Defaults on Debt
#zaporizhia nuclear plantukraine warthetruthcentralbanking crisiscalifornia debt defaultcarbon 60climate change policyeconomic collapsefdicfiscal irresponsibilityjerome corsijp morganmalthusian depopulationmatt mcmillanneo marxismsilicon valley bankswiss america
00:35:02
05 May
Fri
The Truth Centra...
Dr. Jerome Corsi
Massive Layoffs Coming and the End of Cheap Airline Flights
#shopifyrussia ukraine warquantitative easingcarbon taxeconomic recessionepaeuropean central bankgeopolitical conflictgoldman sachsgreen energy transitioninflation hedgingjerome corsijoe bidenmetamodern monetary theorymonetary policy
00:38:42
02 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Why the 2023 Bank Crash is Worse than 2008; The Return of the North American Union
#solyndranorth american unionjpmorgan chasebanking crisisbengtssonbricsbrics expansionclimate change skepticismdebt ceilingde dollarizationesg investingfdicfederal debtfirst republic bankgold backed currenciesipccjerome corsi
00:34:17
01 May
Mon
The Truth Centra...
Dr. Jerome Corsi
First Republic Fallout; Fed Ponders Rate Hikes; Stagflation Around the Bend
#washington mutualvital cukraine warbank failuresbiden administrationclimate change debatecommercial real estatederivatives marketeconomic downturnelectric vehiclesfdicfirst republic bankinterest rate riskjerome corsijpmorgan chaseneo marxistsobama administrationopecrare earth minerals
00:33:18
28 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Why the Gradual Global Financial Collapse Could Turn Into a Crash
#xrpthe last generationswiss americaantonio gramscicentral bank digital currencyclimate policycloward piven strategycritical theorycultural maoismeconomic collapseeuropean union carbon taxfederal reservefednowfinancial sovereigntyfrankfurt schooljerome corsimodern monetary theoryneo marxism
00:33:40
27 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
The Biden Crime Family Story is Not Going Away; Poland and Italy Stand Up to EU Power Grab
#world economic forumviktor orbanrobert f kennedy jrbill gatescapitalismclimate changedonald trumpeconomic collapseenergy policyfirst republic bankgiorgia meloniglobalismjerome corsijoe bidenklaus schwabmanhattan institutemark mills
00:34:54
26 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
BRICS Buying Gold and More Nations Want In While West Worries About Climate Change
#xrpwagner groupus economic declinebiden administrationbricsbrics expansionchevy boltclimate change denialenergy policy critiqueeu offshore wind farmgary genslergeneral motorsgeopolitical conflictjerome corsisecthe truth centralukraine war
00:34:56
24 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Ukraine Wants Endless Streams of Military Aid; BRICS Continue to Undermine Dollar
#wagner groupukraine warthe truth centralandrei melnykbakhmutbricsbureau of labor statisticsclimate change denialde dollarizationeconomic crisishunter bideninflation reduction actjerome corsimichelle obamanato expansionswiss america
00:34:28
20 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Biden to Punish Good-Credit Homebuyers; Climate Change Zealots Attack Rice
#world economic forumunaidsrobert kennedy jrbiden administrationclimate change hoaxeminent domain abuseglobal governance critiqueharrison brownincome redistributioninternational commission of juristsjerome corsiminor attracted personsnet zero emissionspaul ehrlichpedophilia decriminalizationproject sentinel
00:34:03
19 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
The Looming Global Debt Catastrophe
#truth centralstephen jenstagflationaccenturebanking system instabilitybrookfield asset managementcommercial real estate collapsecommercial real estate debtde dollarizationdollar smile theoryernst and youngglobal economic crisisgoldman sachsgreen energy policyinflation reduction actjerome corsimckinseymoodysmorgan stanleyregional bankssolyndra
00:36:50
18 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Riots in Blue Cities; The Petroyuan on the Rise
#washington postukraine warukraine grain importsbakhmutclimate changeelectric vehicleseurodollar systemeuropean unionfischer tropsch synthesisglobal governancegreen movementgulf cooperation councilhungaryjerome corsilondon gold poolpetrodollarpetro yuanpoland
00:34:01
17 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
The Federal Reserve is Bankrupt
#world economic forumukraine warthe truth centralcarbon 60china populationcommercial real estatedemographic shiftseconomic recessionfederal reservefederal reserve policygeopolitical conflictgreat resetindia populationinflation crisisjerome corsim2 money supplyponzi schemetaiwan conflict
00:34:06
14 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Kremlin, NATO, Fight for the Black Sea Area; Oil Rises Again
#ukrainetruth centralsolyndrabiden administrationbureau of labor statisticsclimate changedepartment of justicedonald trumpeconomic policyepa mandatefederal reserveinflationinternational energy agencyjerome corsinatonato expansionneo marxismoil pricesopec
00:35:11
12 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Globalists Make Bold Moves: Unicoin and a Digital ID System
#xrpuniversal monetary unitsilicon valley bankbanking crisisbiden administrationcentral bank digital currencyclimate change policyeminent domaingovernment surveillanceimproving the digital identity act of 2023international monetary fundjamie dimonjanet yellenjerome corsikelo v new londonkirsten sinemarussia ukraine war
00:37:07
11 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Big Bank CEO Wants Private Property Seized for Climate Agenda - The Truth Central
#the truth centraltennessee goldnew york timesbiden administrationclimate change policycritical race theorydaniel greenfielddr benny pizereconomic inequalityelectric vehiclesfront page magazinegovernment overreachjamie dimonjerome corsijp morgan chasekarine jean pierremark moranomarxist critique
00:33:59
10 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Nuclear Energy's Future and Is Commercial Real Estate the Next to Fall?
#ukrainethe truth centraltaiwancarbon 60china us relationsdarien gapeconomic declineglobal conflictgold standardgordon changhamashezbollahhong kongisraeljerome corsikevin mccarthymitch mcconnellreligious prophecyrussia ukraine warswiss america
00:34:06
07 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Censorship, Disinformation and 5th Generation Warfare
#unrestricted warfarethe shroud codexswiss americacentral bank digital currenciesclimate change denialdiscerntvdisinformation campaignsedward bernaysepoch timesfifth generation warfaregeneral gerasimovgeorge sorosjean baudrillardjerome corsiorange revolutionpostmodernismrand institutesimulacra and simulation
00:37:32
06 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
As the Dollar and US Economy are Crumbling, Biden and Yellen Double Down on Climate Hysteria
#water vaporwalking liberty half dollarsshanghai cooperation organizationbiden administrationclimate change policyeconomic stabilityfederal reservegeopoliticsjanet yellenjerome corsijohn holdrenmalthusian movementneo marxismnet zero transitionpaul ehrlich
00:36:17
05 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Global De-Dollarization is Accelerating
#xrpwalking liberty half dollarsthetruthcentralcombiden administrationbric economic blocbric nationscentral bank digital currenciescoronal mass ejectionsglobal de dollarizationgold price forecastjerome corsikenyan shillingsopec pluspetrodollar systemsec lawsuitsshanghai cooperation organizationstagflation risksswiss america
00:33:59
04 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Oil to Hit $100? Gold to Reach $2000? Finland to Join NATO
#xrpwall streetvladimir putinchinacryptocurrency regulationfinlandgetlongevitymedscomgold investmentjerome corsimetforminmyvitalcnatonato expansionoil market manipulationopecrussiarussia china alliancesecswiss americaus economic decline
00:32:42
03 Apr
Mon
The Truth Centra...
Dr. Jerome Corsi
Jerome Corsi Podcast Project
#vladimir putinstagflationsilicon valley bankesg investmentsfederal reservegeopolitical shiftglobal recessiongold standardgreen agenda critiqueinflation crisisjerome corsimcdonaldsmodern monetary theoryneo marxistsnouriel roubinioil price surgeopec
00:35:59
31 Mar
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr. Jerome Corsi on Trump's Indictment; The Coming Decline of the U.S. Dollar
#zoltan pozarthe great awakening trilogystormy danielsbinancebretton woods 3cftccryptocurrency regulationdonald trumpeconomic collapseftxglobal reserve currencyjerome corsijoe bidenjulian assangemanhattan prosecutorsmueller investigationneo marxismpolitical prosecutionsec
00:31:02
30 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
The Truth Central - France Paying for Oil in Yuan; US Mortgage Industry in Danger
#yuanxrpus dollarbretton woods agreementbretton woods collapsechinacultural maoismdollar hegemonyeconomic recessionfinancial censorshipfrancegeopolitical alliancesiran nuclear programjerome corsineo marxismsaudi arabiastellarswift systemthe truth central
00:37:38
29 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
Nuclear Energy's Future and Is Commercial Real Estate the Next to Fall?
#woke secular propagandathe truth centralswiss americacarbon 60central bank digital currencychris burryclimate change denialcommercial real estatedean heskineconomic collapseenergy policyjerome corsimalthusian goalsmodern monetary theorymy vital cnew world order
00:33:26
28 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
20230328_Tue_v2clkh8.mp4
#woke agendawater vaporunited nationscarbon dioxideclimate changeeconomic policyelectric vehiclesgas stovesgreenhouse gaseshydrocarbon fuelsintergovernmental panel on climate changeipccipcc reportjerome corsimalthusian communist agendarobert mueller
00:05:30
28 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
Climate Change Alarmism and Will There Only Be a Few Banks Left Standing Soon?
#washington postsocial credit scoringsilent no more2008 financial crisisbanking instabilitycentral bank digital currencyclimate change denialclimate doomersfiat currency collapsegold and silvergreat awakeninghockey stick graphipccjerome corsijimmy cartermalthusian agendamichael mannneo marxismrobert mueller
00:32:47
27 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
The Banking Crisis, Inflation, Ukraine and the Coming Recession
#ukraine warthe gateway punditsilicon valley bankamerican thinkercentral bank digital currenciesclimate changeconspiracy theoriescredit suissecryptocurrencydonald trumpeconomic crisisfederal reservegeopoliticsgeorge sorosjerome corsimaidan revolutionmitch mcconnellmueller investigation
00:24:33
18 Jan
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 01/18/21: A New Chapter Begins Now
#tele md programswiss americashroud of turincorsi nationde platformingdrcorsicomfinancial serviceshydroxychloroquinejerome corsikennedy assassinationmartin luther king jrmedia transitionpolitical strategyreligious beliefs
00:11:14
07 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 01-07-21: Inventing the Future
#swiss americashroud of turinreligious fundamentalismamerica for saleantifaconspiracy theoriescorsinationcomdominion voting systemsdonald trumpdulles brotherseconomic collapseelection integrityjerome corsijfk assassinationlyndon b johnsonmike pencepolitical polarization
00:52:51
06 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 01-06-21: Trump Will Continue the Fight
#yi jianmingvice president pencemike penceantifablack lives matterbohai harvest investment groupconstitutional crisisdominion voting systemsdonald trumpelection fraud claimselectoral count actelectoral count act of 1887hunter bidenjanuary 6 insurrectionjerome corsijoe bidenkristi noem
01:19:41
05 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr. Corsi SPECIAL BROADCAST 01-05-21: Trump Prepares To Go To WAR!
#wisconsinpolitical polarizationpennsylvaniaantifabiden familyblack lives matterchina conspiracychuck grassleydominion voting machinesdominion voting systemsdonald trumpelection fraudgeneral michael flynngeorge soroshunter bidenjanuary 6 insurrectionjerome corsimark zuckerbergmike pence
01:04:56
01 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 01-01-21: The New Year Starts With Trump Win
#voter fraud claimssupreme courtreligious nationalism12th amendmentbill de blasioconstitutional crisisdepartment of justicedominion voting systemsdonald trumpelectoral integrityfbijanuary 6jerome corsimaga partymike pencemitch mcconnellpolitical polarization
00:50:20
31 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-31-20: Case Closed - Georgia Gives OK to Determine Fraud
#voter suppressionsection 230rudy giuliani2020 election fraudanthony faucibrad raffenspergerchinese communist partycovid 19 treatmentsdominion voting systemsdonald trumpjeffrey epsteinjerome corsijohn robertsjosh hawleymaga movementmike pencemitch mcconnellpolitical conspiracy theories
01:17:33
28 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-28-20: The MAGA Party Demands a Second Term for President Trump
#wikileakssidney powellmike penceantifablack lives matterconspiracy theoriescovid 19donald trumpelection fraudfederal reservejanet yellenjanuary 6jerome corsijoe bidenjulian assangemaga movementmaga party
01:18:28
27 Dec
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST: 12-27-20 The Rise of the MAGA Party
#wuhan labvalley forgesidney powellantifaconspiracy theoriescovid 19dominion voting machineselection fraudfirst amendmentgeorge washingtonhunter bidenjerome corsijoshua marchmaga partypolitical polarizationqanonreligious nationalism
01:03:35
24 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-24-20: Patrick Byrne Explains Trump Path To Victory
#sidney powellrudy giulianireligious themeschinaconspiracy theoriesdominion voting machinesdonald trumpelection fraudgeorge washingtonjanuary 6jerome corsimark meadowsmedia censorshipmichael flynnpatrick byrnepolitical resistanceprayerful patriot
01:38:48
21 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-21-20: Trump Celebrates Christmas Victory over Biden
#vladimir putinsolarwindssidney powellchina influencedeep statedominion voting systemsdonald trumpelection fraudjerome corsijoe bidenkamala harrismitch mcconnellnight of the long knivespatrick byrnepolitical purgesrudy giulianirussian cyberattacks
01:45:05
19 Dec
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-19-20: Trump Shuts Down Biden Transition
#peter strzokmedia censorshipmagaantrim countyboris johnsonchristopher millercuban missile crisisdeep state conspiracydominion voting systemsdonald trumpelection integrityforeign interferencejerome corsijoe bidenjohn ratcliffejulian assange
01:53:53
18 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-18-20: BOOM! Trump Readies Emergency Declaration
#ubs securitiessupreme courtsolarwindsconspiracy theoriesdominion voting systemsdonald trumpelection fraudforeign interferencegoldman sachsguantanamo bayhunter bideninsurrection actjerome corsijohn ratcliffejohn robertsmilitary tribunalspatriot movement
01:20:02
17 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-17-20: Evidence of Voter Fraud Mounts
#ted cruzsolarwindssidney powellbig tech censorshipconspiracy theoriesdeep state plotdi dongshengdominion voting systemelection fraudforeign interferencehunter bidenjanuary 6thjerome corsijoe bidenjohn ratcliffemark zuckerbergnew york postrudy giuliani
01:10:24
15 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-15-20: Wray, Haspel, Milley - They ALL Must Go!
#william barrsupreme courtsolarwindschinadominion voting systemsdonald trumpelection fraudelectoral collegeelectoral college votesf 35 technologyforeign interferencehunter bidenjanuary 6th insurrectionjeffrey rosenjerome corsijoe bidenmartial law
00:49:31
14 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-14-20: Time To Fire Barr
#william barrrosemont senecamike haydenantrim countybohai harvestchina influenceconspiracy theoriesdana nesseldeep statedominion voting machinesdonald trumpelection fraudgeorge soroshunter bidenhunter biden laptopjerome corsijoe bidenjohn ratcliffematthew dipernomichael flynn
01:16:46
13 Dec
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-13-20: CHINA CHINA CHINA !
#william barrviktor shokinukraine scandalavicbank of chinabohai harvestburismacgnchina collusiondemocratic partyelection fraudhunter bidenhunter biden laptopjerome corsijoe bidenkolomoiskymalia obamamarie yovanovitchnational security
00:54:55
12 Dec
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-12-20: TRUMP STILL WINS!
#voter fraud claimssupreme courtspiritual warfare12th amendment25th amendmentantifaconstitutional lawdonald trumpelectoral collegehunter bidenjanuary 6th certificationjerome corsijoe bidenkamala harrismaxine watersmike pencesidney powell
01:12:26
11 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-11-20: Trump Winning At SCOTUS
#xi jinpingtexas v pennsylvaniapolitical polarizationact 77constitutional lawcsisdeep state conspiracydonald trumpelection integrityelectoral collegefourth reichgeorge sorosglobalismjerome corsijoe bidenjohn robertspennsylvania supreme court
01:05:11
07 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr. Corsi SPECIAL BROADCAST: Is A Revolution Inevitable?
#supreme courtsheriff joe arpaiosecond amendment14th amendmentbundy familycorsi v bidendeep statedominion voting systemelection fraudelectoral collegegeorgia senateharry reidjerome corsijudge emmett sullivanlarry klaymanmichael flynnpolitical revolution
00:38:25
06 Dec
Sun
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-06-20: How Trump Defeats Lawfare
#wisconsinsupreme court petitionsidney powellabbott v perezbarack obamaconstitutional crisiscraigdonald trumpedward foleyelection fraud claimselectoral collegegeorge sorosgeorgiajerome corsilawfare strategymichigannancy pelosipennsylvaniarudy giuliani
00:22:57
05 Dec
Sat
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 12-05-20: TO WIN TRUMP MUST GAME LAWFARE TIMETABLE
#nancy pelosimike pencelawfarealan dershowitzamistad projectchinese communist partyconstitutional crisisdonald trumpdr zelenkoedward foleyelection fraudelectoral count actelizabeth warrenjanuary 6 insurrectionjerome corsijia wujoe bidenlarry tribe
02:08:57
04 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-04-20: Corsi Files Petition At SCOTUS
#sidney powellrudy giulianipsyop2020 election fraudbarack obamabrad raffenspergerbrian kempconspiracy theoriesdonald trumpelectoral college disputefulton countyhillary clintonjeff zuckerjerome corsimail in ballot controversyoperation mockingbirdpolitical polarization
01:03:40
03 Dec
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-03-20: Trump Goes to SCOTUS
#trump winstcf centersidney powellabbott v perezbill barrconstitutional lawdonald trumpelection fraudelectoral collegefinancial independenceglobalismhunter bidenjerome corsimedia censorshiprudy giuliani
00:56:59
01 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 12-01-20: How Trump Wins
#supreme court strategystate legislature powersidney powellarticle 2barack obamabush v goreconspiracy theoriesdepartment of justicedominion voting systemselection fraudelectoral collegeimmigration policyjericho marchesjerome corsimcpherson v blackerprescott bushrudy giuliani
01:17:38
30 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-30-20: New eBook TRUMP WINS! 100% Certain
#trump winssupreme court strategyprayerful patriot2020 election fraudalan dershowitzantifaarticle iiblack lives matterbush v goreconstitutional lawdeep state conspiracydonald trumpjerome corsijoe bidenkamala harrislawfaremail in voting
01:18:34
25 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-25-20: Trump Has Winning SCOTUS Strategy
#swiss americastate legislature authoritysidney powellabbott v perezarticle twoconstitutional crisisdominion voting machinesdonald trumpelection fraud claimsjericho marchjerome corsijohn robertslegal strategyliberation theologymodern monetary theorypolitical extremismrudy giuliani
01:28:37
24 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-24-20: Trump - The Best Is Yet To Come
#russ ramslandpolitical polarizationnostradamusaocciaconspiracy theoriesdallas election data reviewdepartment of justicedominion voting systemsdonald trumpelection fraudelectoral collegehelp america vote acthydroxychloroquinejerome corsikamala harrisnist
01:24:41
24 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi SPECIAL BROADCAST 11-24-20: 2020 Election and Voter Fraud Exposed
#voting system securitysmartmaticseidel2020 election fraudbexar countycisaclarity electionscybersecurity vulnerabilitiesdallas countydominion voting systemsdonald trumpelection integrityesandsfbigovernment responsehelp americans vote actjerome corsimatt bevinrussell ramsland
00:45:25
23 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-23-20: Trump Corners on Victory
#world health organizationvoter suppressiontucker carlson25th amendmentconspiracy theoriesdominion voting systemsdonald trumpelection fraudgeorge sorosglobalismjericho marchjerome corsinsaoperation mockingbirdpolitical corruptionsidney powelltedros adhanom ghebreyesus
01:24:49
20 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-20-20: Trump Is The Kraken
#wuhan virustucker carlsontedros25th amendmentconspiracy theoriesdominion voting machinesdonald trumpelection fraudfourth reichgeorge sorosglobalist cabalinsurrection actjericho marchjerome corsipolitical censorshipsidney powell
01:24:49
19 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-19-20: Joshua's Trumpet Sounds Victory for Trump
#wayne county board of canvasserstrumpet todaysidney powellalan dershowitzanti communist rhetoricchristopher millerconstitutional authoritydominion voting systemsdonald trumpelection integrityezra cohen watnickforeign policyimperial presidencyjerome corsimark espermichael flynnoperation mockingbirdreligious nationalismrudy giuliani
01:22:51
18 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-18-20: Trump Grandmasters End Game
#yad vashemwilliam hartmanwayne county canvassers2020 election fraudalan dershowitzbull connordemocratic conspiracyhydroxychloroquineisrael iran conflictjerome corsikamala harrismarxist revolutionmonica palmernew world ordersidney powellstate legislature strategyswiss americatrumpet
01:21:12
16 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-16-20: Trump Will Win BIGLY!
#voter suppressiontrump blackstate legislature powerallen dullesconspiracy theoriesdominion voting systemselection fraudgeorge sorosjericho marchesjerome corsimedia censorshipmike pencenancy pelosipeter neffingerrob weaversidney powellsmartmatic
01:11:17
10 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-10-20: Trump Wins Going on Offense
#william barrtrumpetreligious extremism2020 election fraudbush v goreconstitutional lawdeath valleydonald trumpelectoral collegeinsurrection actjericho march 20jerome corsijoe bidenmaiden gatemaricopa countymark esperpennsylvania supreme courtpolitical conspiracy theoriesq movement
01:14:25
09 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-09-20: Trump Wins Endgame
#voter suppressionvirginiapolitical polarizationamy coney barrettbush v goreciaconstitutional lawdaniel 5 21department of justicedonald trumpelection fraudgeorgiajerome corsijoe bidenkyle foxmedia censorshipmichiganpennsylvania
01:11:00
09 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 11-09-20: Mathematical Anomalies of 2020 Election Results
#wayne countyvoter registration integritynancy pelosi14th amendment2020 election fraudantrim countydavid harris jrdominion voting systemselection administrationelectoral college processelectronic registration information centerfisa courtjerome corsikevin wadelexisnexismueller report
01:15:34
06 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-06-20: Trump Wins Exposing the Coup
#william barrvoter fraudmedia censorship2020 electionamy coney barrettbush v gorecarlos slimchristopher wrayconstitutional lawdonald trumpgeorge sorosjack dorseyjanuary 6jeff bezosjerome corsijoe bidenjohn robertsmark zuckerberg
01:29:31
06 Nov
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 11-05-20: Defeating Voter Fraud to Maintain Voter Integrity
#william koenigsupreme court interventionstate legislature authority2020 election fraudaaron zielinskiamy coney barrettbarr probebush v gorechris kobachdonald trumpdr carla dean gravesdurham probeelection lawfarejeannie rheejerome corsijoe bidenjohn robertsmail in ballot irregularitiesruth bader ginsburg
01:20:24
05 Nov
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-05-20: Trump is On Track to Win Re-election
#voter fraudsteve bannonsidney powell2020 electionalexander hamiltonbush v goreconstitutional lawdonald trumpelectoral collegeinsurrection actjames okeefejerome corsijoe bidenmaidan rebellionpolitical conspiracyproject veritasrudy giuliani
01:13:15
04 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-04-20 Why DEMs Will Not Succeed in Stealing Election
#zincxi jinpingtelemdamy coney barrettchina us relationscovid 19 treatmentsdonald trumpdr zelenkoelection fraudhunter bidenhydroxychloroquinejerome corsijoe bidenmail in ballotssupreme courttaiwan
01:02:58
03 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-03-20: Trump Surges as Biden Fades
#wick pollingvoter suppressionreligious nationalismchoose democracycoast to coast amdevon archerdonald trumpelection fraudgovernment subversiongreen new dealhold the linehunter bidenjerome corsijoe bidenmedicare for allpolitical polarizationpsalm 27
01:07:55
02 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 11-02-20: Biden Campaign Implodes
#xi jinpingthe little red book of democrat socialist liesstephen k bannon2020 us electionamerica for salebarack obamachina influencecommunist conspiracycraigcultural marxismdavos global economic forumdonald trumpgreat resetheart peace projecthunter bidenhunter biden scandaljerome corsijoe bidenkamala harris
01:05:47
30 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-30-20 - Larry Klayman's New Book It Takes a Revolution
#william kellersheldon whitehouserichard burrbell atlantic versus twomblycitizen revolutionclinton foundationconstitutional rightsdeep state theorydianne feinsteingloria navarroinsurrection actit takes a revolutionjerome corsijoe arpaiojudicial corruptionjudicial watchlarry klaymanmedia censorshipmichael avenatti
01:03:08
29 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS: Thurs Oct 29 Biden Campaign Collapses in Scandal
#voter fraudtwitter censorshiptwitterbarack obamaburismaconspiracy theoriesdevin archerdr faucidr zelenkoeconomic collapsehunter bidenhunter biden scandalhydroxychloroquinejack dorseyjerome corsijoe bidenmail in votingmark zuckerbergswiss americatony bobulinski
01:06:23
28 Oct
Wed
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 10-28-20: Hiden Biden Back In The Bunker
#voter suppressiontony bobulinskiswiss america22nd amendment25th amendmentantifabarack obamablack lives matterconspiracy theorieselection fraudgeorge soroshunter bidenhydroxychloroquinejerome corsijoe bidenmedia censorshippolitical coup
01:02:59
23 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi NEWS 10-23-20: Trump Wins Last Debate
#us national debttony bobulinskisino hawkbelt and road initiativecefc china energycraig arthurdeep statedonald trumpfiat currencygold standardhunter bidenhunter biden laptopimfjerome corsijoe bidenleslie stahlobamacareruth bader ginsburg
01:14:14
22 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-21-20: Evangelicals Under Attack
#trump administrationsupreme court appointmentsruth bader ginsburgabraham accordsamy coney barrettbarna groupblack lives mattercultural marxismcyrus the greatevangelical politicsgeorge soroshunter bidenisaiah 45israel palestine conflictjerome corsiobergefellreligious libertyroe v wade
01:22:23
22 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-22-20: Dinesh D'Souza New Movie Trump Card
#ulysses s granttrump cardstormy danielsabraham lincolnaccess hollywood tapeamerican dreamcivil war eradeep statedemocratic partydinesh dsouzahugo chavezilhan omarjerome corsimedia censorshipmichael flynnobama administrationroger stonesocialism
01:08:38
20 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Dr Corsi DEEP DIVE Interview 10-20-20: Danielle D'Souza Gill 's New Book - The Choice
#the choicestephen k bannonspiritual accountabilityabortion ethicsbuddhismconstitutional lawdanielle dsouza gilldaoismdinesh dsouzafetal developmentfreakonomicshinduismjerome corsimargaret sangermayo clinicplanned parenthoodsave the storks
01:04:04