« Back to Topics
No selection means all shows.

biden administration

88 episodes

Filters
Date Range
30 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
How Deep Does the Act Blue Financial Fraud Scandal Go?
#weaponized earthquakesstephord jonessean tayloract blueact blue scandalamerican thinkerbiden administrationburismahunter bidenjerome courcymark finchemmortgage fraudnunes reportobama administrationpolitical corruptionregina wallace jonesrussian interference
00:19:22
23 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Seduction and Grooming The Darkness Under Silicon Valley’s Cloak - Part 5
#silicon valleysilicon satansexual revolutionadrenochromeadrenochrome industryaleister crowleybiden administrationchild sexual exploitationconspiracy theoriescraig lunddr jerome courcyherbert marcusejeffrey epsteinjfk assassinationp diddypost hill pressred scarfing
00:47:59
17 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Seduction and Grooming: The Darkness Under Silicon Valley’s Cloak - Part 5
#wheres wallysilicon valleysilicon satanadrenochromearchbishop mccarrickbiden administrationchild safetyconspiracy theoriescorsi nationcraig lundherbert marcusejerome corsijfk assassinationmike mccormickpost hill presssatanic panicsexual revolution
00:48:24
04 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Defending Religious Freedom in the U.S. with Chaplain Gordon (Dr. Chaps) Klingenschmitt
#sec nav instruction 17307creligious freedompray in jesus name ministriesabortion rightsbiden administrationchristian persecutioncountry of particular concerndonald c winterdr chapsemtalafirst amendmentgordon klingenschmittjohn warnermanipurmilitary policy
00:51:11
07 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
The Left’s DOGE Meltdowns Continue as Corruption and Abuse Continue to be Exposed
#usaidreligious freedompope francis2024 electionandrew paquetteantifabiden administrationblack lives mattercarlo maria viganòchuck schumerdeep statedemocratic partyelection fraudelon muskhakeem jeffriesjerome corsineo marxismpeter tiktin
00:35:31
31 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
The Washington Helicopter-Plane Crash: Beyond the Headlines
#swiss americarobert f kennedy jrrichard blumenthalaviation safetybernie sandersbiden administrationconspiracy theoriescritical race theorydeidepartment of transportationeconomic collapseelection fraudelizabeth warrenfaagods5stonesjerome corsikash patelpete buttigiegpolitical corruption
00:45:05
22 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
The Trump Administration is Off and Running: DEI is Dead, J6 Protesters Pardoned and More
#transgender rightsoperation warp speedmrna vaccinesanthony faucibiden administrationbill gatesdei cancellationdonald trumpeconomic collapseglobalist conspiracygold rushjanuary 6th insurrectionjerome corsikash patellauren boebertlgbtq+ criticismliz cheneymark zuckerberg
00:29:19
03 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
The Biden Administration Considered Attacking Iran
#wisconsintrump administrationthe truth central9 11 attacksarizonabarack obama birth certificatebiden administrationbuilding 7conspiracy theoriescritical race theoryeconomic collapseelection irregularitiesforeign policyiran nuclear facilitiesjerome corsikash patellee harvey oswaldmichigannevadapennsylvania
00:45:24
30 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Exposing Corruption of the Deep State and Biden Admin as Trump Prepares for Presidency
#yuval noah harariworld war iiiwoke agendabiden administrationcultural marxismdeep statedemocratic partydepartment of justicediversity equity and inclusiondonald trumpelection fraudjerome corsinational debtrobert muellerukraine conflictvladimir putinvoter fraud
00:37:29
20 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
No, It's Not Okay for the Government to Constantly Lie to Us, What Today's Leaders Can Learn from History
#washington postwall street journaltransgender rightsbiden administrationbill gateschristopher wrayclimate change denialdonald trumpeconomic collapseelection interferenceigor shafarevichjerome corsijohn robertsjonathan cahnjulian assangemerrick garlandmeta instagramnew york timessocial media censorship
00:42:47
04 Dec
Wed
The Truth Centra...
Dr. Jerome Corsi
The Democrats' Devious Smear Campaign Against Pete Hegseth
#volodymyr zelenskytucker carlsontony blinken14th amendmentbiden administrationbricsburismaconspiracy theoriescraig lunddonald trumpeconomic collapseelection fraudforeign policygods five stoneshunter bidenjerome corsipolitical corruption
00:38:50
27 Nov
Wed
The Truth Centra...
Dr. Jerome Corsi
Why NATO’s Tough Talk of a Pre-Emptive Attack on Russia Will Backfire
#yuval noah hararivoter fraudukraine warandrew paquettearchbishop viganobiden administrationcalifornia district 28economic preparednesselection integrityforeign policygods five stonesjerome corsikamala harrismichael waltznatonato strategyrussiasebastian gorkaswiss america
00:43:15
19 Nov
Tue
The Truth Centra...
Dr. Jerome Corsi
Ukraine Launches ATACMS Missiles on Russia, Putin Lowers Nuclear Strike Threshold
#voter fraudvladimir putinukraine war2026 electionsatacms missilesbiden administrationcritical theorydeep statedonald trumperic hovdejerome corsimatt gaetzneo marxismnuclear conflictpennsylvania supreme courtsilicon satanswiss americathetruthcentral
00:34:40
07 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Hillary Angry Over ‘Losing Control’ Without Social Media Censorship; Suspect Voter Roll Code Found in Battleground State
#war in ukrainevenezuelan gangsukraine warbiden administrationbric nationsdepartment of educationeconomic collapseelection integritygods five stonesgold standardhillary clintonhurricane miltonimmigration policyisrael iran conflictjerome corsisocial media censorship
00:28:33
18 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
New Updates on Ohio's Investigation into a Corrupt Algorithm Within its Official Voter Database
#voter fraudthetruthcentralreligious extremismandrew paquettebiden administrationciademocratic partyelection integritygods five stonesjerome corsikamala harrismedia biasnew world orderohio voter databasepolitical conspiracy
00:31:46
21 Aug
Wed
The Truth Centra...
Dr. Jerome Corsi
The Real Steal Update: More on Suspicious Voter Roll Algorithms in Ohio and other states
#voter fraudvita supplementssonos devicesandrew paquettebiden administrationciacoach davecryptographic algorithmscuyahoga countydemocratic partydr jerome corsielection integrityfrank laroseluciferian influencensaohio electionsprice waterhousesatanic influence
00:48:54
05 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
US Markets, Nikkei Plummets: Is a Global Market Collapse Coming?
#volodymyr zelenskyswiss americasharia lawanti globalist alliancebiden administrationdeep stateelection integrity claimsglobal stock market crashgods five stonesgold and silver investinghyperinflation risksjerome corsijfk assassinationkamala harrisnational debtnikkeipolitical conspiracy theoriesreligious end times
00:25:01
17 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
Why the Secret Service Chief and DEI Need to Be Fired; Is China Readying for War?
#xi jinpingukraine conflictsecret serviceanti globalist alliancebiden administrationconspiracy theoriesdeep statedonald trumpdr jerome corsieconomic collapsegold and silver pricesjfk assassinationnational securitypresidential campaigns
00:27:21
16 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
More Questions Surround Trump Assassination Attempt; Biden Blames Trump for Violent Political Rhetoric
#ukraine warsecret servicerobert f kennedy jrbiden administrationconspiracy theoriesdeep statedonald trumpeconomic collapsefederal reservegold and silverinternational corruptionjd vancejerome corsimike pencepolitical assassination
00:32:03
02 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
The Left is in a Tizzy over SCOTUS Immunity Ruling
#vatican schismtranshumanismswiss america2 chronicles 7 14archbishop viganobiden administrationcardinal mccarrickconspiracy theoriesdonald trumpeconomic inflationfreemasonrygeorge sorosglobal governancejoan corsilawfarepope francispresidential immunitysupreme court
00:40:30
07 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
The Biden Administration’s Latest Political Stunt Targets Steve Bannon
#world war iiiukraine russia wartranshumanismbiden administrationbill gateschina pakistan relationsdavid mattisdonald trumpeconomic recessionjanuary 6th committeejerome corsijulian assangekaja kallaskharkovkievlawfarenational debtsaudi arabiasteve bannonswiss america
00:39:24
23 May
Thu
The Truth Centra...
Dr. Jerome Corsi
Behind the Biden Administration's Authorization of Use of Deadly Force for Trump Home Raid
#vaccine safetysupreme courtrobert kennedy jrbiden administrationbill gatesbreonna taylordeep state conspiracydonald trumpdr manticeconomic collapseedward fogartyjerome corsijfk assassinationlee harvey oswaldlipid nanoparticlesmar a lagonoah hararinuclear warpfizerreligious freedom
00:38:30
14 May
Tue
The Truth Centra...
Dr. Jerome Corsi
Why America's Middle Class has Reached its Breaking Point
#war room bookstransgender rightstides foundationbiden administrationeconomic declineepageorge sorosglobal politicshezbollahhouthi rebelsiran revolutionary guardisrael gaza conflictjfk assassinationlee harvey oswaldopen society foundationrichard nixonsteve bannon
00:33:44
30 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
While Biden's Gaffes Crack Us Up, The Counter-State is Destroying America
#the final analysisroe v wademartin luther king jrbiden administrationclimate changeconspiracy theoriesdeep stateforeign policygender ideologygeorge sorosgrassy knollgreen new dealjerome corsijohn f kennedylee harvey oswald
00:46:47
26 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
The Alvin Bragg Embarrassment Worsens; Has the Deep State Become a Counter-State?
#ukrainethetruthcentraltaiwanalvin braggbiden administrationclimate policydeep statedonald trumpeconomic collapseepaforeign aidharvey weinsteinisraeljerome corsijpmorganlawfarenatonew york timesreligious moralityshugerman
00:44:31
17 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Will Israel Attack Iran? The Spying Power-Up Hidden in the FISA Re-Authorization
#world war iiithetruthcentralopen bordersbiden administrationcultural revolutiondavid camerondonald trumpeconomic collapseeuropean court of human rightsfisa reauthorizationgovernment surveillanceiranisraelisrael iran warjerome corsilawfaremahdinsa
00:48:20
11 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Over 3 Years of #Bidenomics: What the Media Doesn't Want You to Know; Iran Preps to Attack Israel
#the final analysisprescott bushnatobiden administrationblackrockciadavid manticdeep statedeep state conspiracyesg fundsesg investment crisisgreen energyiran israel warisrael iran conflictjerome corsijfk assassinationjfk skull x raysjohn foster dullesmercury bullets
00:41:30
05 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
The WEF's War on Farmers and a Mainstream Journalism Extinction Event
#washington poststeve bannonroe v wadeagenda 2030anti globalist alliancebiden administrationbill gatesconspiracy theorieseconomic policygeopolitical conflictisrael hamas warjohn f kennedyjohn kerrymark victor hansenmedia censorshipnew york timesonyx dr jerome corsepolitical polarizationreligious fundamentalism
00:29:10
26 Mar
Tue
The Truth Centra...
Dr. Jerome Corsi
#Baltimore in Disarray After Key #BridgeCollapse; US-#Israel Relations Deteriorating After UNSC Gaza Vote
#world war iiiukraine conflictreligious fundamentalismbenjamin netanyahubiden administrationclimate change denialconspiracy theoriescrime and punishmentdefund the policeforeign policyfrancis scott key bridgegreen energy agendaipccisrael hamas warjerome corsijohn f kennedypolitical corruptionpost modernism
00:35:58
18 Mar
Mon
The Truth Centra...
Dr. Jerome Corsi
How Texas Could Truly Secure the Border; Biden Doubles Down on Net Zero Rules
#the final analysisterrablock barrierslee harvey oswaldassassination plotsbiden administrationblack swan eventscarlo maria viganòciaconspiracy theoriesdepartment of justiceeconomic collapseelon muskfbiglobalismgovernment corruptionjerome corsijohn f kennedy
00:51:08
14 Mar
Thu
The Truth Centra...
Dr. Jerome Corsi
Fani Willis' Loses Again; Putin Sending Troops to Finland Border; Credit Card Delinquencies Rise
#wallethubswedenrussiabiden administrationclimate changedonald trumpdr david manticdr jerome corsieconomic declinefani willisfinlandgeorge sorosgovernment conspiracyjfk assassinationjohn f kennedylee harvey oswaldmedia censorshipnatonato expansionnet zero goals
00:27:57
06 Mar
Wed
The Truth Centra...
Dr. Jerome Corsi
The Truth About Weaponized Migration; How the Fed is Responsible for the U.S. Debt Crises
#victoria nulandron paulpolitical corruptionarchbishop viganobiden administrationchicago gang violenceeconomic collapseelaine chaofederal reservegeorge sorosgold investmenthouthisjerome corsimitch mcconnellopen border policies
00:53:12
27 Feb
Tue
The Truth Centra...
Dr. Jerome Corsi
Putin's New Nuclear Threat, Biden Admin Underestimates the Houthis, More Fani Follies
#ukraine conflictukrainereligious conservatismbiden administrationdonald trumpeconomic collapsefani willishezbollahhouthisiranjanuary 6thjeff desantisjens stoltenbergjerome corsimiddle east warnatonuclear warpolitical corruptionputinrafael grossi
00:32:28
22 Feb
Thu
The Truth Centra...
Dr. Jerome Corsi
Hard Truths About Ukraine Surface as Russia Takes Avdeevka
#woke ideologiesukraine wartranshumanismavdiivkabiden administrationciadepartment of justicedonald trumpdonetskdr jerome corsieconomic declineglobalist agendamike pencenatonet zero policiesnuclear war riskpaul ryanrussia ukraine conflictthetruthcentralcom
00:39:26
09 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
Inside the World Health Organization's Dangerous and Aggressive Power Grab with Dr. Kat Lindley
#world health organizationwho authoritysocial credit scorearticle 18article 44biden administrationcentral bank digital currenciesdepartment of health and human servicesdigital vaccine passportsgain of function researchglobal governancejohn kerrynational sovereigntynew hampshire hb 1156one healthpandemic treatypublic health emergencypublic health emergency of international concern
00:46:04
02 Feb
Fri
The Truth Centra...
Dr. Jerome Corsi
How Much Closer Are We to War with Iran? CA, NY May Soon Lead a Wave of State Bankruptcies
#world economic forumukraine conflictsubstackbiden administrationcameron campanella iichristopher wrayclinton foundationcloudhubcloward piven strategygreen energy policyhillary clintoniran nuclear programisrael hamas warjanuary 6 insurrectionjerome corsijohn kerryjohn podestapinochek
00:37:39
26 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
Several Govs Back Abbott on Border Battle with Biden; Marxists Move to Brainwash Kindergarteners
#world economic forumreligious conspiracyneo marxismagenda 2030biden administrationborder crisiscarlo maria viganòcritical race theoryfrank marshall davisgen zglobal governancegreg abbottjack kawanolgbt identity
00:58:16
25 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
Border Showdown: Texas vs DC; Political Showdown: Kari Lake vs. The Swamp
#world economic forumus immigration policytran tifaagenda 2030america for salebiden administrationchina economic crisisgender identity issuesglobalist conspiracy theoriesgovernment corruptionhouthi rebelsjeff dewittjerome corsikari lakenational guardtexas border crisis
00:40:32
23 Jan
Tue
The Truth Centra...
Dr. Jerome Corsi
Disease X: The Globalists‘ New Weapon
#world health organizationworld economic forumunited airlinesbiden administrationblinkenchinese communist partydemocratic party criticismdisease xeconomic collapseglobalist conspiracyhamashenry kissingerhezbollahiranisrael hamas warjerome corsimarxist ideologynational security memorandum 200obama administrationthe truth central
00:33:47
19 Jan
Fri
The Truth Centra...
Dr. Jerome Corsi
Davos is Deflating -- As Are Lawfare vs. Trump and Democrat-Run Cities
#world health organizationworld economic forumvolodymyr zelenskybetruecentralcombiden administrationcritical race theorycultural maoismdavosdepopulation theorydr jerome corsigeorge soroshouthi rebelsnato expansionneo marxismopen borders debatepresident trumpred sea shippingreligious ethics
00:45:37
17 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
How the World Health Organization Can Force a Global Lockdown - with Dr. Kat Lindley
#yuval noah harariworld health organizationworld economic forumbiden administrationbill gatescentral bank digital currenciesdonald trumpeconomic crisisglobalist agendagovernment surveillanceinternational health regulationsjake sullivanjerome corsimilitary industrial complexnikki haleypandemic treatytedros adhanom ghebreyesustucker carlsonvivek ramaswamy
01:03:02
11 Jan
Thu
The Truth Centra...
Dr. Jerome Corsi
The Fall of Destructive ESG & DEI Policies
#world health organizationvivek ramaswamyukraine warbiden administrationcarbon dioxide pipelinechris christieclimate changecritical gender theorycritical race theorydiversity equity and inclusionesgethanol mandatesgender identityglobalismhamasinternational conflictreligious valuessteve kingswitzerland
00:47:20
10 Jan
Wed
The Truth Centra...
Dr. Jerome Corsi
Bloated DEI Departments Jacking Up College Costs
#university of michigantruth centralneo marxismal bureji refugee campbiden administrationburismacritical race theorycultural maoismdei departmentseconomic declineelectric vehicle marketenvironmental movementesg initiativesgazahunter bidenhunter biden corruptionisrael hamas warisraeli defense forcesjerome corsi
00:48:28
19 Dec
Tue
The Truth Centra...
Dr. Jerome Corsi
The Pentagon: A Multi-Trillion Dollar Financial Fraud?
#thetruthcentralpentagonnuclear energy policyben carsonbenjamin netanyahubiden administrationclimate change debateclinton foundationcop28department of energygazagovernment corruptionhamashouthi rebelshunter bideniranisrael hamas warjerome corsineo marxismnet zero
00:50:44
18 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Inside the Projected $97 Billion in Global Debt; The US Ukraine Aid-Border Showdown Continues
#ukraine wartruth centralneo marxism97 trillion debtbiden administrationclimate changeclinton foundationcop28critical race theorydemographic declinedepopulation plangaza conflictglobal debt crisishamashenry kissingerjerome corsi
00:47:00
08 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
A Bad Week for the Bidens: Impeachment Inquiry for Joe, New Charges for Hunter
#world economic forumunited nationsthe truth centralbiden administrationclimate change denialgazahamashunter bidenhunter biden scandalinflation reduction actiranisrael hamas warjerome corsijoe bidenjoe biden impeachmentjohn kerrymuslim brotherhoodneo marxist conspiracy
00:46:14
06 Dec
Wed
The Truth Centra...
Dr. Jerome Corsi
Biden-Touted E-Bus Company Goes Bust; Is the EU Slowly Admitting the Truth About the Ukraine War?
#zelenskyukraine conflictthetruthcentralbiden administrationclimate policyeconomic collapsegeorge soroshillary clintonisrael hamas warjerome corsijohn kerrykhan younisnato expansionoctober 7th attackproterraqatarsolyndrasultan al jabbar
00:24:46
04 Dec
Mon
The Truth Centra...
Dr. Jerome Corsi
Hamas and UN as Propaganda Partners; Gold Hits Record High
#unrwa accusationsunrwathe truth centralbiden administrationcarbon 60climate change debatecop28economic collapsegaza citygold marketgold pricehamasiranian influenceisrael hamas warjerome corsijohn kerrymichelle obamamunich olympics massacremy vital coctober 7th attacks
00:35:37
01 Dec
Fri
The Truth Centra...
Dr. Jerome Corsi
Hamas Breaks Treaty, Fighting Resumes; Climate Fanatics Descend on Dubai
#world economic forumviktor orbanukrainebiden administrationbill gatesclimate change policycop28democratic partyeconomic collapseenergy transitiongazagender identityglobalismgold rushhamashenry kissingerhezbollahiranisrael hamas warnato
00:50:05
20 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Argentina Elects Anti-Woke Milei as President; Israel Moves into Tougher Phase of War in Gaza
#woke agendaukrainepolitical polarizationargentinabiden administrationclimate change policycommercial real estate crisisdepopulation movementgazaglobal economic crisishamasiranisrael hamas warjavier mileijerome corsijohn kerrymedia bias
00:38:15
13 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
New Fighting by Israel's Northern Border; 'Scientists' Claim Hottest 12 Months in 125,000 Years
#zelenskyworld war iwoke culture1973 oil embargoamerican politicsbiden administrationchina green energyclimate change skepticismelizabeth warrenglobal economic crisishamashezbollahiranian revolutionary guard corpsisrael hamas warjerome corsijimmy carterkamala harrisploukraine conflict
00:40:11
06 Nov
Mon
The Truth Centra...
Dr. Jerome Corsi
Israel Airstrikes Hit 450 Gaza Targets; A Brutal Week for the Green Agenda
#world war iiivolodymyr zelenskyukraine fatiguebiden administrationdinesh dsouzaeconomic collapseel niñogreen energy transitionhamashezbollahisrael hamas warjerome corsijohn kerryneo marxismoffshore windthe police statetime magazineukraine conflict
00:40:54
19 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
Are We Headed for a New World War?
#world economic forumunited nationsukraine warbiden administrationclimate change hoaxclinton foundationglobal economic crashgold rushgreat resethamashsbciranjerome corsimichael mannmiddle east conflictnatoneo marxists
00:42:58
16 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
FBI Warns of Hamas Attacks on US Soil; Housing Market to Further Sink
#world war iiiuaw strikethe truth centralbiblical prophecybiden administrationcommercial real estateeconomic recessiongold priceshamashezbollahisrael hamas warjerome corsimagogneo marxist policiespolitical impeachmentrobert hur
00:42:28
10 Oct
Tue
The Truth Centra...
Dr. Jerome Corsi
Israel vs. Hamas: The Truth and What's Next?
#yom kippur warworld war iiiopen bordersbiden administrationclimate change activismgazahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsineo marxism
00:50:55
09 Oct
Mon
The Truth Centra...
Dr. Jerome Corsi
Iran Helped Hamas Plan Attack on Israel; Why Oil Could Hit $150 per Barrel
#obama administrationnew world orderneo marxismbiblical prophecybiden administrationclimate change skepticismcloward piven strategycommercial real estate bubbleeconomic crisisepahamashezbollahiraniran israel conflictisraelisrael hamas warjerome corsimilitary industrial complex
00:42:53
06 Oct
Fri
The Truth Centra...
Dr. Jerome Corsi
Biden to Build More of Trump's Border Wall; The Race to be the Next House Speaker
#the truth centralpioneer natural resourcesjim jordanamerican politicsbiden administrationclimate change debatedemocratic partydonald trumpexxonglobal economicsgramscigreen energygreen energy policygreen murderian plimerimmigration policyjerome corsi
00:41:26
05 Oct
Thu
The Truth Centra...
Dr. Jerome Corsi
FBI Targeting Trump Supporters Ahead of 2024 Election; OPEC Says Oil Could Hit $100 per Barrel
#un net zero banking allianceunited auto workersukraine warbiden administrationclimate change denialcultural maoismeconomic collapseeducation reformenergy securityepa mandatesesg policiesfbigeneral motorsgovernment surveillancejerome corsilabor unionslatin massnato expansionopecthetruthcentral
00:35:24
19 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
Zelenskyy to Ask for More Billions; US Debt Topples $33 TRILLION
#victoria nulandukrainian forcesukraine warbiden administrationclimate changeeconomic collapseelectric vehiclesjohn kerryklaus schwabmgm 140 atacmsnational debtnatoneo marxismnuclear conflictpresident zelenskyysafe t act
00:43:31
13 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Biden Impeachment Plans Are a Go; China Using AI to Spread Disinformation
#zelenskyworld economic forumwashington post9 11biden administrationbricsbrics allianceconspiracy theorieseconomic declinehunter bidenimpeachment hearingsjerome corsijfk assassinationjoe bidenkamala harrisnew york timesopecukraine war
00:38:45
12 Sep
Tue
The Truth Centra...
Dr. Jerome Corsi
Biden to Send $6B to Iran; An "Emergency Approval" For the New COVID Vax
#zelenskyukraine warukraine counteroffensivebiden administrationbricsbrics expansionclimate change denialclimate hoaxcovid 19 vaccineseconomic collapseeg5 variantfdafifth circuit courtgold pricesgreen heating lawhunter bideniraniran nuclear dealisraelivermectinjerome corsi
00:36:36
11 Sep
Mon
The Truth Centra...
Dr. Jerome Corsi
How the Government Used 9/11 to Weaponize Itself; The Energy Secretary's Embarrassing EV Photo Op
#warren commissionsidney powellsecond amendmentbiden administrationcovid 19donald trumpelectric vehiclesgovernment surveillanceiranjennifer granholmjfk assassinationjoan corzinemichelle lujan grishammyvitalcpatriot actpaul landis
00:25:53
06 Sep
Wed
The Truth Centra...
Dr. Jerome Corsi
Biden's Deep Ukraine-Maui Funding Disparity; China to Control Global Energy Market?
#world economic forumukraine war fundingtranshumanismbiden administrationbricsburismadonald trumpelection fraudfiat currencyglobal de dollarizationhunter bidenihor kolomoiskyjerome corsemaui wildfiresnato expansionneo marxismswiss america
00:36:33
21 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
U.S. Banks Take $18.9B in Losses; Are "Climate Emergency" Lockdowns Coming?
#world economic forumpolitical polarizationneo marxism401ksbiden administrationbill gatesbricscommercial real estateconspiracy theoriescritical race theorydonald trumpeconomic collapseerisevergrandefinancial crisisglobal governancejerome corsi
00:40:08
14 Aug
Mon
The Truth Centra...
Dr. Jerome Corsi
Why the Ukrainian Counteroffensive is Failing; Will Parts of the US Become Ungovernable?
#westfield topanga mallweaponized dollarultra low emission zonebiden administrationbricsclimate change denialcritical race theoryeconomic collapsegovernment conspiracy theoriesjerome corsinational security study memorandum 200nordstrom storereligious revivaltruth centralukraine counteroffensive
00:38:02
25 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
The Destruction of the Middle Class; Biden Targets Your Water Heater
#robert f kennedy jrpolitical polarizationmedia censorshipbarack obamabiden administrationclimate change denialconspiracy theoriesdepartment of energydigital services actdonald trumpfisa courtsfrank marshall davisgovernment surveillancehillary clintonhunter bidenjerome corsijoe rogankathy hochul
00:34:31
19 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
US Sends Fighter Jets to Gulf of Oman; BRICS Gold-Backed Currency Project Gains Speed
#us dollarukraine warswift sanctionsbiden administrationbricsbrics goldclimate change scienceclimate change skepticismdollar weaponizationf 16 jetsglobal financial crisisiran nuclear programisraeljerome corsiodessaponzi schemeraymond voyagersouth africastrait of hormuz
00:45:35
18 Jul
Tue
The Truth Centra...
Dr. Jerome Corsi
Climate Lockdowns Begin; Pentagon Finally Admits Failure as Ukraine Counter-Offensive Sputters
#zelenskyworld war iiiukraine warbiden administrationblackrockclimate policyeconomic collapseesg investingfbigovernment corruptionjerome corsilarry finknato expansionrobert f kennedy jrthe truth central
00:43:38
13 Jul
Thu
The Truth Centra...
Dr. Jerome Corsi
Bidenomics Equals Stagflation; UN Sustainability Agenda: Destroy the Middle Class
#world economic forumstate farmstagflationallstatebiden administrationclimate changecommercial real estateconsumer price indexcultural maoismelectric vehiclesfarmers insuranceglobal governancegoldimfjerome corsijudith currynationwide mutual
00:43:04
12 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
US vs. NATO Allies on Ukraine Membership; California Crime Surges, Arrests Down
#world war ii originsworld economic forumukraine nato membershipbiden administrationclimate change denialdouglas hornelectric vehicle mandatesfranklin d rooseveltgeorge sorosglobalist conspiracy theorieshillary clintonmaidan revolutionnato article 5nitrogen fertilizerspearl harborthe mccollum memorandum
00:37:50
07 Jul
Fri
The Truth Centra...
Dr. Jerome Corsi
Americans Lost $1.76 TRILLION in Savings Since 2020; The Recession We Were Expecting is Already Here
#united states recessionthetruthcentralsocial media regulationaffirmative actionaffirmative action decisionasian americansbiden administrationcalifornia exoduscritical race theorycultural marxismeconomic collapsejerome corsinational debtneo marxistspersonal savings ratepolitical migrationsocial media censorship
00:40:11
05 Jul
Wed
The Truth Centra...
Dr. Jerome Corsi
Another Victory for Free Speech over Censorship; What Happens if the BRICS Launch a New Currency?
#xrpwalking liberty half dollarus dollarbiden administrationbricsbrics allianceclimate change denialde dollarizationeconomic collapsegold standardgovernment censorshipjerome corsilouisiana injunctionopecreligious freedomroe v wadeswift systemthe coming global crash
00:37:21
28 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
Iran Close to Testing First Nukes; EU Wants to Block Out the Sun
#the truth centralsvensmarksolyndrabiden administrationbill gatesbud lightchristensenclimate changecultural decaydonald trumpeconomic declinehamashunter bidenipccjerome corsilordstown motorspolitical corruptionsolar activity
00:40:08
26 Jun
Mon
The Truth Centra...
Dr. Jerome Corsi
Biden's Catastrophic Failures, Macron's International Tax Plan and China's Failing Economy
#truth centralnato article 5milankovitch cyclesbiden administrationclimate change denialconspiracy theorieseconomic collapseesg investinghermeticahunter bidenjerome corsijohn kerryjonathan cahnklaus schwablondon breed
00:37:35
23 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
New Bank Crisis Looms; The UN Plans a Digital Censorship Compact
#wells fargourban decaytitan submersiblebanking crisisbiden administrationcitizens bankcommercial real estatecultural marxismcustomers bancorpdepartment of justicedigital currencydurham reporterisa pensionsesg rulesfaucifederal reserve policygarlandhunter bidenjerome corsianjp morgan chasekiwi grocery storespacwestportlandrema 1000san franciscosanta monicaseattle
00:45:24
14 Jun
Wed
The Truth Centra...
Dr. Jerome Corsi
The Trump Indictment: Weak and Embarrassing - A Deep Dive into the "Charges"
#world economic forumpresidential records actpresidential indictmentamy berman jacksonbiden administrationbill clintonclimate changecultural marxismdonald trumpespionage actespionage act of 1917hillary clintoniranisrael nuclear weaponsjerome corsijohn kerrykohei saitomatt gaetznational debtnewsmax
00:43:15
09 Jun
Fri
The Truth Centra...
Dr. Jerome Corsi
Trump Indictment: US Has Become a Banana Republic; NATO May Send Troops to Ukraine
#seth richreligious freedomproposition 47biden administrationchristopher wrayclimate change skepticismcoup detatcriminalization of politicsdonald trumpeconomic collapseinstagramjohn robertsjulian assangemetapolitical witch hunt
00:41:12
08 Jun
Thu
The Truth Centra...
Dr. Jerome Corsi
Here Come the Climate Lockdowns; Global Economic Growth Sinks
#washington posttransgender ideologythetruthcentralcombiden administrationcanadian wildfiresclimate changecritical race theorydepartment of energydr jerome corsieconomic crisisgold and silvergreen movementpride monthreligious freedom
00:38:35
31 May
Wed
The Truth Centra...
Dr. Jerome Corsi
The Tide Turns Against Climate Change Fanatics; Debt Ceiling Agreement Orders Student Loan Payments to Resume
#zerohedgeukraine warstudent loansantarctic doomsday glacierbiden administrationclimate changedean heskindebt ceilingepoch timesgeopoliticshans mohnkehillary clintoninflationjerome corsistudent loan forgiveness
00:36:28
01 May
Mon
The Truth Centra...
Dr. Jerome Corsi
First Republic Fallout; Fed Ponders Rate Hikes; Stagflation Around the Bend
#washington mutualvital cukraine warbank failuresbiden administrationclimate change debatecommercial real estatederivatives marketeconomic downturnelectric vehiclesfdicfirst republic bankinterest rate riskjerome corsijpmorgan chaseneo marxistsobama administrationopecrare earth minerals
00:33:18
26 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
BRICS Buying Gold and More Nations Want In While West Worries About Climate Change
#xrpwagner groupus economic declinebiden administrationbricsbrics expansionchevy boltclimate change denialenergy policy critiqueeu offshore wind farmgary genslergeneral motorsgeopolitical conflictjerome corsisecthe truth centralukraine war
00:34:56
20 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
Biden to Punish Good-Credit Homebuyers; Climate Change Zealots Attack Rice
#world economic forumunaidsrobert kennedy jrbiden administrationclimate change hoaxeminent domain abuseglobal governance critiqueharrison brownincome redistributioninternational commission of juristsjerome corsiminor attracted personsnet zero emissionspaul ehrlichpedophilia decriminalizationproject sentinel
00:34:03
14 Apr
Fri
The Truth Centra...
Dr. Jerome Corsi
Kremlin, NATO, Fight for the Black Sea Area; Oil Rises Again
#ukrainetruth centralsolyndrabiden administrationbureau of labor statisticsclimate changedepartment of justicedonald trumpeconomic policyepa mandatefederal reserveinflationinternational energy agencyjerome corsinatonato expansionneo marxismoil pricesopec
00:35:11
13 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
The UN Seeks New Global Powers; Biden Doubles Down on EV Mandates
#world economic forumwall street journalstagflationbernie madoffbiden administrationbill gatesclimate change denialeconomic stagflationelectric vehiclesepa mandatefederal reservefordglobal governanceinflation reduction actnatorussia ukraine conflictrussia ukraine war
00:36:27
12 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Globalists Make Bold Moves: Unicoin and a Digital ID System
#xrpuniversal monetary unitsilicon valley bankbanking crisisbiden administrationcentral bank digital currencyclimate change policyeminent domaingovernment surveillanceimproving the digital identity act of 2023international monetary fundjamie dimonjanet yellenjerome corsikelo v new londonkirsten sinemarussia ukraine war
00:37:07
11 Apr
Tue
The Truth Centra...
Dr. Jerome Corsi
Big Bank CEO Wants Private Property Seized for Climate Agenda - The Truth Central
#the truth centraltennessee goldnew york timesbiden administrationclimate change policycritical race theorydaniel greenfielddr benny pizereconomic inequalityelectric vehiclesfront page magazinegovernment overreachjamie dimonjerome corsijp morgan chasekarine jean pierremark moranomarxist critique
00:33:59
06 Apr
Thu
The Truth Centra...
Dr. Jerome Corsi
As the Dollar and US Economy are Crumbling, Biden and Yellen Double Down on Climate Hysteria
#water vaporwalking liberty half dollarsshanghai cooperation organizationbiden administrationclimate change policyeconomic stabilityfederal reservegeopoliticsjanet yellenjerome corsijohn holdrenmalthusian movementneo marxismnet zero transitionpaul ehrlich
00:36:17
05 Apr
Wed
The Truth Centra...
Dr. Jerome Corsi
Global De-Dollarization is Accelerating
#xrpwalking liberty half dollarsthetruthcentralcombiden administrationbric economic blocbric nationscentral bank digital currenciescoronal mass ejectionsglobal de dollarizationgold price forecastjerome corsikenyan shillingsopec pluspetrodollar systemsec lawsuitsshanghai cooperation organizationstagflation risksswiss america
00:33:59